BLASTX nr result
ID: Forsythia21_contig00030467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00030467 (339 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077037.1| PREDICTED: uncharacterized protein LOC105161... 72 1e-10 >ref|XP_011077037.1| PREDICTED: uncharacterized protein LOC105161140 [Sesamum indicum] Length = 1393 Score = 72.0 bits (175), Expect = 1e-10 Identities = 40/83 (48%), Positives = 51/83 (61%) Frame = -1 Query: 249 ESEDSILKPDVILSDSKDVNLGCLKDFDRTNSGTAHGNKSVPHAGLESIHELSFVSERGE 70 ES+DSILK + + SD ++ N G L +FD T + HG + V H G E I++ S VSER E Sbjct: 354 ESKDSILKANELASDIENKNQGPLNEFDGTKVESNHGIEGVSHVGPEPINDKSLVSERVE 413 Query: 69 VTTMNVDGVLDVKDEGLGIDLPD 1 + D VLD KDE L ID PD Sbjct: 414 AISSVFDDVLDFKDESLNIDPPD 436