BLASTX nr result
ID: Forsythia21_contig00030336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00030336 (296 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP08305.1| unnamed protein product [Coffea canephora] 68 2e-09 ref|XP_010091969.1| putative WRKY transcription factor 50 [Morus... 68 3e-09 gb|AIY62468.1| WRKY38 [Gossypium aridum] 66 1e-08 gb|AIE43860.1| WRKY transcription factor 112 [Gossypium hirsutum] 66 1e-08 ref|XP_012449571.1| PREDICTED: probable WRKY transcription facto... 66 1e-08 ref|XP_010935437.1| PREDICTED: probable WRKY transcription facto... 65 1e-08 ref|XP_008220528.1| PREDICTED: probable WRKY transcription facto... 65 1e-08 ref|XP_008220527.1| PREDICTED: probable WRKY transcription facto... 65 1e-08 ref|XP_010047371.1| PREDICTED: probable WRKY transcription facto... 65 1e-08 gb|AKA27918.1| WRKY protein [Salvia miltiorrhiza] 65 2e-08 ref|XP_012489455.1| PREDICTED: probable WRKY transcription facto... 65 2e-08 ref|XP_011100937.1| PREDICTED: probable WRKY transcription facto... 65 2e-08 ref|XP_011019388.1| PREDICTED: probable WRKY transcription facto... 65 2e-08 gb|AIE43862.1| WRKY transcription factor 114 [Gossypium hirsutum] 65 2e-08 ref|XP_002308538.1| hypothetical protein POPTR_0006s24050g [Popu... 65 2e-08 ref|XP_011657375.1| PREDICTED: probable WRKY transcription facto... 64 3e-08 ref|XP_008445519.1| PREDICTED: probable WRKY transcription facto... 64 3e-08 gb|ABA39425.1| putative WRKY transcription factor [Capsicum frut... 64 3e-08 ref|XP_006351605.1| PREDICTED: probable WRKY transcription facto... 64 3e-08 ref|XP_004245065.1| PREDICTED: probable WRKY transcription facto... 64 3e-08 >emb|CDP08305.1| unnamed protein product [Coffea canephora] Length = 183 Score = 68.2 bits (165), Expect = 2e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNH 205 IEGCPVKKR+ERDKEDPRYV+TTYEGIHNH Sbjct: 148 IEGCPVKKRVERDKEDPRYVITTYEGIHNH 177 >ref|XP_010091969.1| putative WRKY transcription factor 50 [Morus notabilis] gi|587858332|gb|EXB48299.1| putative WRKY transcription factor 50 [Morus notabilis] Length = 192 Score = 67.8 bits (164), Expect = 3e-09 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNHSS 199 +EGCPVKKR+ERD+EDPRYV+TTYEG+HNH S Sbjct: 159 VEGCPVKKRVERDREDPRYVITTYEGVHNHQS 190 >gb|AIY62468.1| WRKY38 [Gossypium aridum] Length = 157 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNHSS 199 I+GCPVKKR+ERDKEDP YV+TTYEGIHNH S Sbjct: 124 IDGCPVKKRVERDKEDPSYVITTYEGIHNHRS 155 >gb|AIE43860.1| WRKY transcription factor 112 [Gossypium hirsutum] Length = 157 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNHSS 199 I+GCPVKKR+ERDKEDP YV+TTYEGIHNH S Sbjct: 124 IDGCPVKKRVERDKEDPSYVITTYEGIHNHRS 155 >ref|XP_012449571.1| PREDICTED: probable WRKY transcription factor 50 [Gossypium raimondii] gi|543887236|gb|AGV75944.1| WRKY transcription factor 38 [Gossypium hirsutum] gi|763798548|gb|KJB65503.1| hypothetical protein B456_010G098000 [Gossypium raimondii] Length = 157 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNHSS 199 I+GCPVKKR+ERDKEDP YV+TTYEGIHNH S Sbjct: 124 IDGCPVKKRVERDKEDPSYVITTYEGIHNHRS 155 >ref|XP_010935437.1| PREDICTED: probable WRKY transcription factor 50 [Elaeis guineensis] Length = 206 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 291 EGCPVKKRIERDKEDPRYVVTTYEGIHNHSS 199 EGCPVKKR+ERDKEDP YV+TTYEGIHNH S Sbjct: 149 EGCPVKKRVERDKEDPSYVITTYEGIHNHMS 179 >ref|XP_008220528.1| PREDICTED: probable WRKY transcription factor 50 isoform X2 [Prunus mume] Length = 162 Score = 65.5 bits (158), Expect = 1e-08 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNHSS 199 +EGCPVKKR+ERD++DPR+V+TTYEGIHNH S Sbjct: 130 VEGCPVKKRVERDRDDPRFVITTYEGIHNHQS 161 >ref|XP_008220527.1| PREDICTED: probable WRKY transcription factor 50 isoform X1 [Prunus mume] Length = 163 Score = 65.5 bits (158), Expect = 1e-08 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNHSS 199 +EGCPVKKR+ERD++DPR+V+TTYEGIHNH S Sbjct: 131 VEGCPVKKRVERDRDDPRFVITTYEGIHNHQS 162 >ref|XP_010047371.1| PREDICTED: probable WRKY transcription factor 50 [Eucalyptus grandis] gi|629114584|gb|KCW79259.1| hypothetical protein EUGRSUZ_C00675 [Eucalyptus grandis] Length = 159 Score = 65.5 bits (158), Expect = 1e-08 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNH 205 +EGCPVKKR+ERD++DPRYV+TTYEGIHNH Sbjct: 126 VEGCPVKKRVERDRDDPRYVITTYEGIHNH 155 >gb|AKA27918.1| WRKY protein [Salvia miltiorrhiza] Length = 171 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNH 205 IEGCPVKKR+ERDKED RYVVTTYEGIHNH Sbjct: 137 IEGCPVKKRVERDKEDRRYVVTTYEGIHNH 166 >ref|XP_012489455.1| PREDICTED: probable WRKY transcription factor 50 isoform X1 [Gossypium raimondii] gi|763739572|gb|KJB07071.1| hypothetical protein B456_001G021500 [Gossypium raimondii] Length = 173 Score = 64.7 bits (156), Expect = 2e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNHSS 199 IEGCPVKKR+ERD EDP YV+TTYEGIHNH S Sbjct: 140 IEGCPVKKRVERDGEDPSYVITTYEGIHNHQS 171 >ref|XP_011100937.1| PREDICTED: probable WRKY transcription factor 50 [Sesamum indicum] Length = 184 Score = 64.7 bits (156), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNH 205 +EGCPVKKR+ER KEDPRYVVTTYEGIHNH Sbjct: 150 VEGCPVKKRVERYKEDPRYVVTTYEGIHNH 179 >ref|XP_011019388.1| PREDICTED: probable WRKY transcription factor 50 [Populus euphratica] Length = 165 Score = 64.7 bits (156), Expect = 2e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNHSS 199 +EGCPVKKR+ERD++DPRYV+TTYEGIH H S Sbjct: 132 VEGCPVKKRVERDRDDPRYVITTYEGIHTHQS 163 >gb|AIE43862.1| WRKY transcription factor 114 [Gossypium hirsutum] Length = 162 Score = 64.7 bits (156), Expect = 2e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNHSS 199 IEGCPVKKR+ERD EDP YV+TTYEGIHNH S Sbjct: 129 IEGCPVKKRVERDGEDPSYVITTYEGIHNHQS 160 >ref|XP_002308538.1| hypothetical protein POPTR_0006s24050g [Populus trichocarpa] gi|222854514|gb|EEE92061.1| hypothetical protein POPTR_0006s24050g [Populus trichocarpa] Length = 165 Score = 64.7 bits (156), Expect = 2e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNHSS 199 +EGCPVKKR+ERD++DPRYV+TTYEGIH H S Sbjct: 132 VEGCPVKKRVERDRDDPRYVITTYEGIHTHQS 163 >ref|XP_011657375.1| PREDICTED: probable WRKY transcription factor 50 isoform X2 [Cucumis sativus] Length = 126 Score = 64.3 bits (155), Expect = 3e-08 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNHSS 199 +EGCPVKKR+ERD+EDP+YV+TTYEG+H H S Sbjct: 94 VEGCPVKKRVERDREDPKYVITTYEGVHTHES 125 >ref|XP_008445519.1| PREDICTED: probable WRKY transcription factor 50 [Cucumis melo] Length = 153 Score = 64.3 bits (155), Expect = 3e-08 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNHSS 199 +EGCPVKKR+ERD+EDP+YV+TTYEG+H H S Sbjct: 121 VEGCPVKKRVERDREDPKYVITTYEGVHTHES 152 >gb|ABA39425.1| putative WRKY transcription factor [Capsicum frutescens] Length = 166 Score = 64.3 bits (155), Expect = 3e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNH 205 +EGCPVKKR+ERDKED RYV+TTYEG+HNH Sbjct: 131 VEGCPVKKRVERDKEDSRYVITTYEGVHNH 160 >ref|XP_006351605.1| PREDICTED: probable WRKY transcription factor 51-like [Solanum tuberosum] Length = 170 Score = 64.3 bits (155), Expect = 3e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNH 205 +EGCPVKKR+ERDKED RYV+TTYEG+HNH Sbjct: 135 VEGCPVKKRVERDKEDSRYVITTYEGVHNH 164 >ref|XP_004245065.1| PREDICTED: probable WRKY transcription factor 75 [Solanum lycopersicum] Length = 181 Score = 64.3 bits (155), Expect = 3e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 294 IEGCPVKKRIERDKEDPRYVVTTYEGIHNH 205 +EGCPVKKR+ERDKED RYV+TTYEG+HNH Sbjct: 146 VEGCPVKKRVERDKEDSRYVITTYEGVHNH 175