BLASTX nr result
ID: Forsythia21_contig00030285
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00030285 (326 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJX98317.1| hypothetical protein TI39_contig418g00006 [Zymose... 56 8e-06 >gb|KJX98317.1| hypothetical protein TI39_contig418g00006 [Zymoseptoria brevis] Length = 1054 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +2 Query: 218 EPEAPGLTFLYTVPAECENSLYESQGPRGIRKAIPI 325 EP APGL FLYT A C N++Y +QGPRGIR AIPI Sbjct: 899 EPTAPGLVFLYTAYAVCNNAIYATQGPRGIRTAIPI 934