BLASTX nr result
ID: Forsythia21_contig00030214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00030214 (229 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI25208.3| unnamed protein product [Vitis vinifera] 62 1e-07 >emb|CBI25208.3| unnamed protein product [Vitis vinifera] Length = 161 Score = 62.4 bits (150), Expect = 1e-07 Identities = 33/52 (63%), Positives = 40/52 (76%), Gaps = 6/52 (11%) Frame = +3 Query: 3 EHFEFPISQKIPL----LVHSSSN*ID--DLAMMEFLFCLLNHMKFYPTPYL 140 EHF FPI +K P+ LVHSSSN +D +LA+MEF+ LLNHMKFYPTPY+ Sbjct: 110 EHFLFPIYRKNPIIVIGLVHSSSNDMDRSNLAIMEFIIRLLNHMKFYPTPYI 161