BLASTX nr result
ID: Forsythia21_contig00030170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00030170 (423 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082956.1| PREDICTED: actin-related protein 2/3 complex... 65 2e-08 ref|XP_010273478.1| PREDICTED: actin-related protein 2/3 complex... 62 1e-07 ref|XP_010035887.1| PREDICTED: actin-related protein 2/3 complex... 58 3e-06 ref|XP_012830393.1| PREDICTED: actin-related protein 2/3 complex... 58 3e-06 >ref|XP_011082956.1| PREDICTED: actin-related protein 2/3 complex subunit 1A [Sesamum indicum] gi|747072116|ref|XP_011082958.1| PREDICTED: actin-related protein 2/3 complex subunit 1A [Sesamum indicum] gi|747072118|ref|XP_011082959.1| PREDICTED: actin-related protein 2/3 complex subunit 1A [Sesamum indicum] Length = 375 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -2 Query: 422 SILAMKKAGDSIATQFSTSGLDGKVVIWDLQSQKDLSEYL 303 +I+ +KK GD+ TQFSTSGLDGKVVIW+LQSQ DLSEYL Sbjct: 336 NIVPLKKPGDTAVTQFSTSGLDGKVVIWELQSQDDLSEYL 375 >ref|XP_010273478.1| PREDICTED: actin-related protein 2/3 complex subunit 1A [Nelumbo nucifera] Length = 378 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 419 ILAMKKAGDSIATQFSTSGLDGKVVIWDLQSQKDLSEYL 303 IL +KKAGD+I +FSTSGLDGKVVIWDL++Q D+S YL Sbjct: 340 ILPLKKAGDAIVKRFSTSGLDGKVVIWDLENQTDISSYL 378 >ref|XP_010035887.1| PREDICTED: actin-related protein 2/3 complex subunit 1B-like [Eucalyptus grandis] gi|629080942|gb|KCW47387.1| hypothetical protein EUGRSUZ_K01189 [Eucalyptus grandis] Length = 378 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -2 Query: 419 ILAMKKAGDSIATQFSTSGLDGKVVIWDLQSQKDLSEYL 303 I+ + +AG S T+FSTSGLDGKVVIWDL+SQ+DL EYL Sbjct: 340 IVPLGEAGSSTITRFSTSGLDGKVVIWDLESQQDLLEYL 378 >ref|XP_012830393.1| PREDICTED: actin-related protein 2/3 complex subunit 1A-like [Erythranthe guttatus] gi|604348201|gb|EYU46356.1| hypothetical protein MIMGU_mgv1a008285mg [Erythranthe guttata] Length = 379 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -2 Query: 422 SILAMKKAGDSIATQFSTSGLDGKVVIWDLQSQKDLSEYL 303 S++ +KKAG + T FSTSGLDGK+VIW+L+ Q+DL EYL Sbjct: 340 SVVPLKKAGGTTITSFSTSGLDGKIVIWELEKQEDLLEYL 379