BLASTX nr result
ID: Forsythia21_contig00029780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00029780 (247 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008029241.1| hypothetical protein SETTUDRAFT_94331 [Setos... 100 3e-19 ref|XP_007685506.1| hypothetical protein COCMIDRAFT_88724 [Bipol... 100 3e-19 ref|XP_003296988.1| ubiquitin-40S ribosomal protein S31 fusion p... 100 3e-19 ref|XP_001941819.1| ubiquitin-40S ribosomal protein S31 fusion p... 100 3e-19 gb|KIW11051.1| ubiquitin-40S ribosomal protein S27a [Exophiala s... 100 6e-19 ref|XP_003839401.1| similar to ubiquitin / ribosomal protein S27... 100 6e-19 ref|XP_007583549.1| putative ubiquitin-40s ribosomal protein s31... 99 8e-19 gb|KIN01001.1| hypothetical protein OIDMADRAFT_54142 [Oidiodendr... 99 1e-18 gb|KGO72985.1| Ribosomal protein S27a [Penicillium italicum] 99 1e-18 ref|XP_008076828.1| Ubiquitin-like protein [Glarea lozoyensis AT... 99 1e-18 gb|KGO51378.1| Ribosomal protein S27a [Penicillium expansum] 99 1e-18 gb|KGO36957.1| Ribosomal protein S27a [Penicillium expansum] gi|... 99 1e-18 ref|XP_002559374.1| Pc13g09510 [Penicillium rubens Wisconsin 54-... 99 1e-18 ref|XP_002143991.1| ubiquitin-40S ribosomal protein S31 fusion p... 99 1e-18 dbj|GAD99010.1| ubiquitin [Byssochlamys spectabilis No. 5] 99 1e-18 emb|CEJ56355.1| Putative Ubiquitin [Penicillium brasilianum] 98 2e-18 ref|XP_754493.1| ubiquitin (UbiC) [Aspergillus fumigatus Af293] ... 98 2e-18 ref|XP_001399835.1| ubiquitin-40S ribosomal protein S31 fusion p... 98 2e-18 ref|XP_001271126.1| ubiquitin-40S ribosomal protein S31 fusion p... 98 2e-18 ref|XP_001213837.1| ubiquitin-40S ribosomal protein S31 fusion p... 98 2e-18 >ref|XP_008029241.1| hypothetical protein SETTUDRAFT_94331 [Setosphaeria turcica Et28A] gi|482806488|gb|EOA83561.1| hypothetical protein SETTUDRAFT_94331 [Setosphaeria turcica Et28A] Length = 154 Score = 100 bits (250), Expect = 3e-19 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEA 109 VDGDGKIERLRRECPQ ECGAG+FMAAMHNRQYCGKCHLTY+FDEA Sbjct: 108 VDGDGKIERLRRECPQPECGAGVFMAAMHNRQYCGKCHLTYVFDEA 153 >ref|XP_007685506.1| hypothetical protein COCMIDRAFT_88724 [Bipolaris oryzae ATCC 44560] gi|628071447|ref|XP_007700377.1| hypothetical protein COCSADRAFT_37257 [Bipolaris sorokiniana ND90Pr] gi|628190168|ref|XP_007708418.1| hypothetical protein COCCADRAFT_1856 [Bipolaris zeicola 26-R-13] gi|451850180|gb|EMD63482.1| hypothetical protein COCSADRAFT_37257 [Bipolaris sorokiniana ND90Pr] gi|451993312|gb|EMD85786.1| hypothetical protein COCHEDRAFT_1228811 [Bipolaris maydis C5] gi|477582722|gb|ENH99827.1| hypothetical protein COCC4DRAFT_207287 [Bipolaris maydis ATCC 48331] gi|576923154|gb|EUC37275.1| hypothetical protein COCCADRAFT_1856 [Bipolaris zeicola 26-R-13] gi|576934418|gb|EUC47932.1| hypothetical protein COCMIDRAFT_88724 [Bipolaris oryzae ATCC 44560] gi|578490879|gb|EUN28291.1| hypothetical protein COCVIDRAFT_36742 [Bipolaris victoriae FI3] Length = 154 Score = 100 bits (250), Expect = 3e-19 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEA 109 VDGDGKIERLRRECPQ ECGAG+FMAAMHNRQYCGKCHLTY+FDEA Sbjct: 108 VDGDGKIERLRRECPQPECGAGVFMAAMHNRQYCGKCHLTYVFDEA 153 >ref|XP_003296988.1| ubiquitin-40S ribosomal protein S31 fusion protein [Pyrenophora teres f. teres 0-1] gi|311330589|gb|EFQ94925.1| hypothetical protein PTT_07252 [Pyrenophora teres f. teres 0-1] Length = 154 Score = 100 bits (250), Expect = 3e-19 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEA 109 VDGDGKIERLRRECPQ ECGAG+FMAAMHNRQYCGKCHLTY+FDEA Sbjct: 108 VDGDGKIERLRRECPQPECGAGVFMAAMHNRQYCGKCHLTYVFDEA 153 >ref|XP_001941819.1| ubiquitin-40S ribosomal protein S31 fusion protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977912|gb|EDU44538.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 154 Score = 100 bits (250), Expect = 3e-19 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEA 109 VDGDGKIERLRRECPQ ECGAG+FMAAMHNRQYCGKCHLTY+FDEA Sbjct: 108 VDGDGKIERLRRECPQPECGAGVFMAAMHNRQYCGKCHLTYVFDEA 153 >gb|KIW11051.1| ubiquitin-40S ribosomal protein S27a [Exophiala spinifera] Length = 154 Score = 99.8 bits (247), Expect = 6e-19 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDE 112 VDGDGKIERLRRECPQ+ECGAG+FMAAMHNRQYCG+CHLTY+FDE Sbjct: 108 VDGDGKIERLRRECPQKECGAGVFMAAMHNRQYCGRCHLTYVFDE 152 >ref|XP_003839401.1| similar to ubiquitin / ribosomal protein S27a [Leptosphaeria maculans JN3] gi|312215970|emb|CBX95922.1| similar to ubiquitin / ribosomal protein S27a [Leptosphaeria maculans JN3] Length = 154 Score = 99.8 bits (247), Expect = 6e-19 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEA 109 VDGDGKIERLRRECPQ ECGAG+FMAAMHNRQYCG+CHLTY+FDEA Sbjct: 108 VDGDGKIERLRRECPQPECGAGVFMAAMHNRQYCGRCHLTYVFDEA 153 >ref|XP_007583549.1| putative ubiquitin-40s ribosomal protein s31 fusion protein [Neofusicoccum parvum UCRNP2] gi|485924071|gb|EOD48984.1| putative ubiquitin-40s ribosomal protein s31 fusion protein [Neofusicoccum parvum UCRNP2] gi|821071529|gb|KKY26531.1| putative ubiquitin-40s ribosomal protein s31 fusion protein [Diplodia seriata] Length = 154 Score = 99.4 bits (246), Expect = 8e-19 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEA 109 VDGDGKIERLRRECPQ +CGAG+FMAAMHNRQYCGKCHLTY+FDE+ Sbjct: 108 VDGDGKIERLRRECPQEQCGAGVFMAAMHNRQYCGKCHLTYVFDES 153 >gb|KIN01001.1| hypothetical protein OIDMADRAFT_54142 [Oidiodendron maius Zn] Length = 155 Score = 99.0 bits (245), Expect = 1e-18 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEAGK 103 VDGDGKIERLRRECP +CGAG+FMAAMH+RQYCG+CHLTYIFDEAGK Sbjct: 108 VDGDGKIERLRRECPTPDCGAGVFMAAMHDRQYCGRCHLTYIFDEAGK 155 >gb|KGO72985.1| Ribosomal protein S27a [Penicillium italicum] Length = 154 Score = 99.0 bits (245), Expect = 1e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEA 109 VDGDGKIERLRRECP ECGAG+FMAAMHNRQYCGKCHLTY+FDEA Sbjct: 108 VDGDGKIERLRRECPAAECGAGVFMAAMHNRQYCGKCHLTYVFDEA 153 >ref|XP_008076828.1| Ubiquitin-like protein [Glarea lozoyensis ATCC 20868] gi|361126118|gb|EHK98134.1| putative Ubiquitin-40S ribosomal protein S27a [Glarea lozoyensis 74030] gi|512207192|gb|EPE36010.1| Ubiquitin-like protein [Glarea lozoyensis ATCC 20868] Length = 155 Score = 99.0 bits (245), Expect = 1e-18 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEAGK 103 VDGDGKIERLRRECP +CGAG+FMAAMH+RQYCG+CHLTYIFDEAGK Sbjct: 108 VDGDGKIERLRRECPTPDCGAGVFMAAMHDRQYCGRCHLTYIFDEAGK 155 >gb|KGO51378.1| Ribosomal protein S27a [Penicillium expansum] Length = 193 Score = 98.6 bits (244), Expect = 1e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEA 109 VDGDGKIERLRRECP ECGAG+FMAAMHNRQYCGKCHLTY+FDEA Sbjct: 147 VDGDGKIERLRRECPAPECGAGVFMAAMHNRQYCGKCHLTYVFDEA 192 >gb|KGO36957.1| Ribosomal protein S27a [Penicillium expansum] gi|700477868|gb|KGO65346.1| Ribosomal protein S27a [Penicillium expansum] Length = 193 Score = 98.6 bits (244), Expect = 1e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEA 109 VDGDGKIERLRRECP ECGAG+FMAAMHNRQYCGKCHLTY+FDEA Sbjct: 147 VDGDGKIERLRRECPAPECGAGVFMAAMHNRQYCGKCHLTYVFDEA 192 >ref|XP_002559374.1| Pc13g09510 [Penicillium rubens Wisconsin 54-1255] gi|211583994|emb|CAP92020.1| Pc13g09510 [Penicillium rubens Wisconsin 54-1255] gi|425767373|gb|EKV05947.1| Ubiquitin [Penicillium digitatum PHI26] gi|425779746|gb|EKV17781.1| Ubiquitin [Penicillium digitatum Pd1] gi|584411801|emb|CDM30566.1| Ubiquitin-40S ribosomal protein S27a [Penicillium roqueforti FM164] Length = 154 Score = 98.6 bits (244), Expect = 1e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEA 109 VDGDGKIERLRRECP ECGAG+FMAAMHNRQYCGKCHLTY+FDEA Sbjct: 108 VDGDGKIERLRRECPAPECGAGVFMAAMHNRQYCGKCHLTYVFDEA 153 >ref|XP_002143991.1| ubiquitin-40S ribosomal protein S31 fusion protein [Talaromyces marneffei ATCC 18224] gi|210073389|gb|EEA27476.1| ubiquitin (UbiC), putative [Talaromyces marneffei ATCC 18224] gi|679998480|gb|KFX50690.1| Ubiquitin-40S ribosomal protein S27a [Talaromyces marneffei PM1] gi|748554607|dbj|GAM39284.1| ubiquitin [Talaromyces cellulolyticus] Length = 154 Score = 98.6 bits (244), Expect = 1e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEA 109 VDGDGKIERLRRECP ECGAG+FMAAMHNRQYCGKCHLTYIFDE+ Sbjct: 108 VDGDGKIERLRRECPSAECGAGVFMAAMHNRQYCGKCHLTYIFDES 153 >dbj|GAD99010.1| ubiquitin [Byssochlamys spectabilis No. 5] Length = 154 Score = 98.6 bits (244), Expect = 1e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEA 109 VDGDGKIERLRRECP ECGAGIFMAAMHNRQYCGKCHLTY+FDE+ Sbjct: 108 VDGDGKIERLRRECPSAECGAGIFMAAMHNRQYCGKCHLTYVFDES 153 >emb|CEJ56355.1| Putative Ubiquitin [Penicillium brasilianum] Length = 154 Score = 98.2 bits (243), Expect = 2e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEA 109 VDGDGKIERLRRECP ECGAGIFMAAMHNRQYCGKCHLTY+FDE+ Sbjct: 108 VDGDGKIERLRRECPSPECGAGIFMAAMHNRQYCGKCHLTYVFDES 153 >ref|XP_754493.1| ubiquitin (UbiC) [Aspergillus fumigatus Af293] gi|119491683|ref|XP_001263336.1| ubiquitin-40S ribosomal protein S31 fusion protein [Neosartorya fischeri NRRL 181] gi|66852130|gb|EAL92455.1| ubiquitin (UbiC), putative [Aspergillus fumigatus Af293] gi|119411496|gb|EAW21439.1| ubiquitin [Neosartorya fischeri NRRL 181] gi|159127510|gb|EDP52625.1| ubiquitin (UbiC), putative [Aspergillus fumigatus A1163] gi|666430037|gb|KEY77668.1| ubiquitin UbiC [Aspergillus fumigatus var. RP-2014] Length = 154 Score = 98.2 bits (243), Expect = 2e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEA 109 VDGDGKIERLRRECP ECGAGIFMAAMHNRQYCGKCHLTY+FDE+ Sbjct: 108 VDGDGKIERLRRECPSPECGAGIFMAAMHNRQYCGKCHLTYVFDES 153 >ref|XP_001399835.1| ubiquitin-40S ribosomal protein S31 fusion protein [Aspergillus niger CBS 513.88] gi|134056756|emb|CAK44245.1| unnamed protein product [Aspergillus niger] gi|358372244|dbj|GAA88848.1| ubiquitin [Aspergillus kawachii IFO 4308] Length = 154 Score = 98.2 bits (243), Expect = 2e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEA 109 VDGDGKIERLRRECP ECGAGIFMAAMHNRQYCGKCHLTY+FDE+ Sbjct: 108 VDGDGKIERLRRECPSPECGAGIFMAAMHNRQYCGKCHLTYVFDES 153 >ref|XP_001271126.1| ubiquitin-40S ribosomal protein S31 fusion protein [Aspergillus clavatus NRRL 1] gi|119399272|gb|EAW09700.1| ubiquitin [Aspergillus clavatus NRRL 1] Length = 173 Score = 98.2 bits (243), Expect = 2e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEA 109 VDGDGKIERLRRECP ECGAGIFMAAMHNRQYCGKCHLTY+FDE+ Sbjct: 127 VDGDGKIERLRRECPSPECGAGIFMAAMHNRQYCGKCHLTYVFDES 172 >ref|XP_001213837.1| ubiquitin-40S ribosomal protein S31 fusion protein [Aspergillus terreus NIH2624] gi|114193406|gb|EAU35106.1| 40S ribosomal protein S27a [Aspergillus terreus NIH2624] gi|849272401|dbj|GAO85208.1| ubiquitin-40S ribosomal protein S27a [Neosartorya udagawae] Length = 154 Score = 98.2 bits (243), Expect = 2e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 246 VDGDGKIERLRRECPQRECGAGIFMAAMHNRQYCGKCHLTYIFDEA 109 VDGDGKIERLRRECP ECGAGIFMAAMHNRQYCGKCHLTY+FDE+ Sbjct: 108 VDGDGKIERLRRECPSPECGAGIFMAAMHNRQYCGKCHLTYVFDES 153