BLASTX nr result
ID: Forsythia21_contig00028620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00028620 (352 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012833751.1| PREDICTED: proteasome subunit alpha type-7 [... 100 4e-19 ref|XP_012837178.1| PREDICTED: proteasome subunit alpha type-7-l... 100 4e-19 gb|AAM64989.1| multicatalytic endopeptidase complex alpha chain ... 100 4e-19 ref|NP_190694.1| 20S proteasome alpha subunit PAD1 [Arabidopsis... 99 8e-19 ref|XP_010515524.1| PREDICTED: proteasome subunit alpha type-7-A... 99 8e-19 gb|KFK34368.1| hypothetical protein AALP_AA5G136200 [Arabis alpina] 99 8e-19 ref|NP_001030838.1| 20S proteasome alpha subunit PAD1 [Arabidop... 99 8e-19 emb|CAA73622.1| multicatalytic endopeptidase [Arabidopsis thalia... 99 8e-19 ref|XP_006393800.1| hypothetical protein EUTSA_v10004820mg [Eutr... 99 8e-19 ref|XP_006291736.1| hypothetical protein CARUB_v10017906mg [Caps... 99 8e-19 ref|NP_201415.1| proteasome alpha subunit D2 [Arabidopsis thalia... 99 8e-19 ref|XP_002876077.1| multicatalytic endopeptidase [Arabidopsis ly... 99 8e-19 ref|XP_002865085.1| hypothetical protein ARALYDRAFT_920118 [Arab... 99 8e-19 ref|XP_011092989.1| PREDICTED: proteasome subunit alpha type-7 [... 99 1e-18 ref|XP_010557631.1| PREDICTED: proteasome subunit alpha type-7-A... 99 1e-18 ref|XP_010557626.1| PREDICTED: proteasome subunit alpha type-7-B... 99 1e-18 ref|XP_009136605.1| PREDICTED: proteasome subunit alpha type-7-A... 98 2e-18 ref|XP_009115803.1| PREDICTED: proteasome subunit alpha type-7-A... 98 2e-18 emb|CDX90655.1| BnaA03g41260D [Brassica napus] 98 2e-18 emb|CDY29009.1| BnaC07g32150D [Brassica napus] 98 2e-18 >ref|XP_012833751.1| PREDICTED: proteasome subunit alpha type-7 [Erythranthe guttatus] gi|604341048|gb|EYU40433.1| hypothetical protein MIMGU_mgv1a012430mg [Erythranthe guttata] Length = 250 Score = 100 bits (249), Expect = 4e-19 Identities = 50/58 (86%), Positives = 55/58 (94%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDT+VLAVEKKSAPKLQ+SR Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTIVLAVEKKSAPKLQDSR 58 >ref|XP_012837178.1| PREDICTED: proteasome subunit alpha type-7-like [Erythranthe guttatus] gi|604333594|gb|EYU37945.1| hypothetical protein MIMGU_mgv1a012461mg [Erythranthe guttata] Length = 250 Score = 100 bits (249), Expect = 4e-19 Identities = 50/58 (86%), Positives = 55/58 (94%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDT+VLAVEKKSAPKLQ+SR Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTIVLAVEKKSAPKLQDSR 58 >gb|AAM64989.1| multicatalytic endopeptidase complex alpha chain [Arabidopsis thaliana] Length = 250 Score = 100 bits (249), Expect = 4e-19 Identities = 51/58 (87%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+ALRKGNA GVRGTDTVVLAVEKKS PKLQ+SR Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEALRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSR 58 >ref|NP_190694.1| 20S proteasome alpha subunit PAD1 [Arabidopsis thaliana] gi|266839|sp|P30186.1|PSA7A_ARATH RecName: Full=Proteasome subunit alpha type-7-A; AltName: Full=20S proteasome alpha subunit D-1; AltName: Full=Proteasome component 6A; AltName: Full=Proteasome subunit alpha type-4; AltName: Full=TAS-G64 gi|16445|emb|CAA47298.1| proteosome alpha subunit [Arabidopsis thaliana] gi|3421080|gb|AAC32058.1| 20S proteasome subunit PAD1 [Arabidopsis thaliana] gi|6562278|emb|CAB62648.1| multicatalytic endopeptidase complex [Arabidopsis thaliana] gi|14596065|gb|AAK68760.1| multicatalytic endopeptidase complex [Arabidopsis thaliana] gi|15450441|gb|AAK96514.1| AT3g51260/F24M12_300 [Arabidopsis thaliana] gi|16974445|gb|AAL31226.1| AT3g51260/F24M12_300 [Arabidopsis thaliana] gi|20148239|gb|AAM10010.1| multicatalytic endopeptidase complex [Arabidopsis thaliana] gi|332645248|gb|AEE78769.1| 20S proteasome alpha subunit PAD1 [Arabidopsis thaliana] gi|742351|prf||2009376B proteasome:SUBUNIT=alpha Length = 250 Score = 99.4 bits (246), Expect = 8e-19 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDTVVLAVEKKS PKLQ+SR Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSR 58 >ref|XP_010515524.1| PREDICTED: proteasome subunit alpha type-7-A-like [Camelina sativa] gi|727501350|ref|XP_010426673.1| PREDICTED: proteasome subunit alpha type-7-A [Camelina sativa] Length = 250 Score = 99.4 bits (246), Expect = 8e-19 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDTVVLAVEKKS PKLQ+SR Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSR 58 >gb|KFK34368.1| hypothetical protein AALP_AA5G136200 [Arabis alpina] Length = 250 Score = 99.4 bits (246), Expect = 8e-19 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDTVVLAVEKKS PKLQ+SR Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSR 58 >ref|NP_001030838.1| 20S proteasome alpha subunit PAD1 [Arabidopsis thaliana] gi|332645249|gb|AEE78770.1| 20S proteasome alpha subunit PAD1 [Arabidopsis thaliana] Length = 243 Score = 99.4 bits (246), Expect = 8e-19 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDTVVLAVEKKS PKLQ+SR Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSR 58 >emb|CAA73622.1| multicatalytic endopeptidase [Arabidopsis thaliana] gi|2511582|emb|CAA73623.1| multicatalytic endopeptidase [Arabidopsis thaliana] Length = 235 Score = 99.4 bits (246), Expect = 8e-19 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDTVVLAVEKKS PKLQ+SR Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSR 58 >ref|XP_006393800.1| hypothetical protein EUTSA_v10004820mg [Eutrema salsugineum] gi|567135889|ref|XP_006393802.1| hypothetical protein EUTSA_v10004818mg [Eutrema salsugineum] gi|557090439|gb|ESQ31086.1| hypothetical protein EUTSA_v10004820mg [Eutrema salsugineum] gi|557090441|gb|ESQ31088.1| hypothetical protein EUTSA_v10004818mg [Eutrema salsugineum] Length = 250 Score = 99.4 bits (246), Expect = 8e-19 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDTVVLAVEKKS PKLQ+SR Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSR 58 >ref|XP_006291736.1| hypothetical protein CARUB_v10017906mg [Capsella rubella] gi|482560443|gb|EOA24634.1| hypothetical protein CARUB_v10017906mg [Capsella rubella] Length = 250 Score = 99.4 bits (246), Expect = 8e-19 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDTVVLAVEKKS PKLQ+SR Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSR 58 >ref|NP_201415.1| proteasome alpha subunit D2 [Arabidopsis thaliana] gi|12229893|sp|O24616.2|PSA7B_ARATH RecName: Full=Proteasome subunit alpha type-7-B; AltName: Full=20S proteasome alpha subunit D-2; AltName: Full=Proteasome component 6B; AltName: Full=Proteasome component 6C; AltName: Full=Proteasome subunit alpha type-4 gi|3421082|gb|AAC32059.1| 20S proteasome subunit PAD2 [Arabidopsis thaliana] gi|10177129|dbj|BAB10419.1| 20S proteasome subunit PAD2 [Arabidopsis thaliana] gi|332010781|gb|AED98164.1| proteasome alpha subunit D2 [Arabidopsis thaliana] Length = 250 Score = 99.4 bits (246), Expect = 8e-19 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDTVVLAVEKKS PKLQ+SR Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSR 58 >ref|XP_002876077.1| multicatalytic endopeptidase [Arabidopsis lyrata subsp. lyrata] gi|297321915|gb|EFH52336.1| multicatalytic endopeptidase [Arabidopsis lyrata subsp. lyrata] Length = 251 Score = 99.4 bits (246), Expect = 8e-19 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDTVVLAVEKKS PKLQ+SR Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSR 58 >ref|XP_002865085.1| hypothetical protein ARALYDRAFT_920118 [Arabidopsis lyrata subsp. lyrata] gi|297310920|gb|EFH41344.1| hypothetical protein ARALYDRAFT_920118 [Arabidopsis lyrata subsp. lyrata] Length = 250 Score = 99.4 bits (246), Expect = 8e-19 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDTVVLAVEKKS PKLQ+SR Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNATVGVRGTDTVVLAVEKKSTPKLQDSR 58 >ref|XP_011092989.1| PREDICTED: proteasome subunit alpha type-7 [Sesamum indicum] Length = 250 Score = 99.0 bits (245), Expect = 1e-18 Identities = 49/58 (84%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDT+VLAVEKKS PKLQ+SR Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTIVLAVEKKSTPKLQDSR 58 >ref|XP_010557631.1| PREDICTED: proteasome subunit alpha type-7-A isoform X2 [Tarenaya hassleriana] Length = 204 Score = 99.0 bits (245), Expect = 1e-18 Identities = 49/58 (84%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDT+VLAVEKKS PKLQ+SR Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTIVLAVEKKSTPKLQDSR 58 >ref|XP_010557626.1| PREDICTED: proteasome subunit alpha type-7-B isoform X1 [Tarenaya hassleriana] Length = 249 Score = 99.0 bits (245), Expect = 1e-18 Identities = 49/58 (84%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDT+VLAVEKKS PKLQ+SR Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTIVLAVEKKSTPKLQDSR 58 >ref|XP_009136605.1| PREDICTED: proteasome subunit alpha type-7-A [Brassica rapa] Length = 250 Score = 98.2 bits (243), Expect = 2e-18 Identities = 49/58 (84%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDTVVLAVEKKS PKLQ++R Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDTR 58 >ref|XP_009115803.1| PREDICTED: proteasome subunit alpha type-7-A [Brassica rapa] gi|674955260|emb|CDX77988.1| BnaA09g31830D [Brassica napus] Length = 250 Score = 98.2 bits (243), Expect = 2e-18 Identities = 49/58 (84%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDTVVLAVEKKS PKLQ++R Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDTR 58 >emb|CDX90655.1| BnaA03g41260D [Brassica napus] Length = 250 Score = 98.2 bits (243), Expect = 2e-18 Identities = 49/58 (84%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDTVVLAVEKKS PKLQ++R Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDTR 58 >emb|CDY29009.1| BnaC07g32150D [Brassica napus] Length = 250 Score = 98.2 bits (243), Expect = 2e-18 Identities = 49/58 (84%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = -2 Query: 168 MARYDRAITVFSPDGHLFQVQYTLDALRKGNA--GVRGTDTVVLAVEKKSAPKLQESR 1 MARYDRAITVFSPDGHLFQV+Y L+A+RKGNA GVRGTDTVVLAVEKKS PKLQ++R Sbjct: 1 MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDTR 58