BLASTX nr result
ID: Forsythia21_contig00028596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00028596 (475 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU17075.1| unknown [Glycine max] 57 6e-06 >gb|ACU17075.1| unknown [Glycine max] Length = 58 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 2/46 (4%) Frame = -3 Query: 302 MALFVFFHSFLELHILKH--CMASNGGDDETFCGSIKLWEDMERVN 171 MALFVFFHSFLELH CM + FCGSIKLWED +RVN Sbjct: 1 MALFVFFHSFLELHPKSSFACMPWHSYSQILFCGSIKLWEDTDRVN 46