BLASTX nr result
ID: Forsythia21_contig00028558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00028558 (247 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001589511.1| hypothetical protein SS1G_09232 [Sclerotinia... 80 5e-13 ref|XP_001560184.1| hypothetical protein BC1G_01016 [Botrytis ci... 74 3e-11 gb|KHJ32579.1| putative related to heatshock protein hsp150 [Ery... 68 3e-09 dbj|GAO18015.1| hypothetical protein UVI_054360 [Ustilaginoidea ... 65 1e-08 gb|KDB13604.1| hypothetical protein UV8b_5436 [Ustilaginoidea vi... 65 1e-08 gb|KIN02398.1| hypothetical protein OIDMADRAFT_162566 [Oidiodend... 65 2e-08 gb|KIW00351.1| hypothetical protein PV09_08063 [Verruconis gallo... 64 5e-08 ref|XP_008082695.1| hypothetical protein GLAREA_13025 [Glarea lo... 64 5e-08 gb|KGQ06244.1| hypothetical protein BBAD15_g8436 [Beauveria bass... 63 9e-08 ref|XP_007297095.1| hypothetical protein MBM_09206 [Marssonina b... 63 9e-08 ref|XP_008601187.1| hypothetical protein BBA_07868 [Beauveria ba... 63 9e-08 gb|ESZ90221.1| hypothetical protein SBOR_9391 [Sclerotinia borea... 62 1e-07 ref|XP_001796562.1| hypothetical protein SNOG_06180 [Phaeosphaer... 59 1e-06 gb|KHN97417.1| hypothetical protein MAM_04432 [Metarhizium album... 59 1e-06 gb|EME45809.1| hypothetical protein DOTSEDRAFT_71487 [Dothistrom... 59 1e-06 ref|XP_007822816.1| hypothetical protein MAA_06627 [Metarhizium ... 59 1e-06 ref|XP_006672895.1| hypothetical protein CCM_07692 [Cordyceps mi... 58 2e-06 ref|XP_007815623.1| hypothetical protein MAC_09283 [Metarhizium ... 57 4e-06 ref|XP_007689641.1| hypothetical protein COCMIDRAFT_38275 [Bipol... 57 6e-06 gb|EMD93241.1| hypothetical protein COCHEDRAFT_1223017 [Bipolari... 57 6e-06 >ref|XP_001589511.1| hypothetical protein SS1G_09232 [Sclerotinia sclerotiorum 1980] gi|154693628|gb|EDN93366.1| hypothetical protein SS1G_09232 [Sclerotinia sclerotiorum 1980 UF-70] Length = 210 Score = 80.1 bits (196), Expect = 5e-13 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = -1 Query: 247 YYRWYICETYVGYQYTTLAWTYGKADPQNPTCQKVNVKRVWANSK 113 YYRWYICETY GY YTTLAW G+A+PQNPTC KV+VKRV+ K Sbjct: 161 YYRWYICETYWGYHYTTLAWVVGEAEPQNPTCVKVDVKRVFVEEK 205 >ref|XP_001560184.1| hypothetical protein BC1G_01016 [Botrytis cinerea B05.10] gi|347833582|emb|CCD49279.1| hypothetical protein BofuT4P22000048001 [Botrytis cinerea T4] gi|472239390|gb|EMR84208.1| hypothetical protein BcDW1_7236 [Botrytis cinerea BcDW1] Length = 202 Score = 74.3 bits (181), Expect = 3e-11 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -1 Query: 247 YYRWYICETYVGYQYTTLAWTYGKADPQNPTCQKVNVKRVW 125 YYRWYICETY GY YTTLAW G+ +PQNPTC KV+V+RV+ Sbjct: 161 YYRWYICETYWGYHYTTLAWVVGEDEPQNPTCVKVDVQRVF 201 >gb|KHJ32579.1| putative related to heatshock protein hsp150 [Erysiphe necator] Length = 198 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = -1 Query: 247 YYRWYICETYVGYQYTTLAWTYGK-ADPQNPTCQKVNV 137 YYRW+ICETY GY+YTTLAW GK + PQNPTCQKV V Sbjct: 156 YYRWFICETYEGYKYTTLAWVLGKYSIPQNPTCQKVTV 193 >dbj|GAO18015.1| hypothetical protein UVI_054360 [Ustilaginoidea virens] Length = 150 Score = 65.5 bits (158), Expect = 1e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 238 WYICETYVGYQYTTLAWTYGKADPQNPTCQKVNVKR 131 WYIC+TY GY YTTLAW G A+PQNP+C KV+VKR Sbjct: 112 WYICKTYFGYTYTTLAWVLGNANPQNPSCVKVDVKR 147 >gb|KDB13604.1| hypothetical protein UV8b_5436 [Ustilaginoidea virens] Length = 183 Score = 65.5 bits (158), Expect = 1e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 238 WYICETYVGYQYTTLAWTYGKADPQNPTCQKVNVKR 131 WYIC+TY GY YTTLAW G A+PQNP+C KV+VKR Sbjct: 145 WYICKTYFGYTYTTLAWVLGNANPQNPSCVKVDVKR 180 >gb|KIN02398.1| hypothetical protein OIDMADRAFT_162566 [Oidiodendron maius Zn] Length = 196 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = -1 Query: 244 YRWYICETYVGYQYTTLAWTYGKADPQNPTCQKVNVKRVWA 122 YRWY+C TY GY Y TLAW G PQNPTC KV+V RV++ Sbjct: 156 YRWYVCTTYEGYTYQTLAWVLGNGTPQNPTCVKVDVLRVFS 196 >gb|KIW00351.1| hypothetical protein PV09_08063 [Verruconis gallopava] Length = 205 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/43 (62%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = -1 Query: 247 YYRWYICETYVG-YQYTTLAWTYGKADPQNPTCQKVNVKRVWA 122 YYRWYIC TY G Y Y TL W G PQNP+CQKV+++RV+A Sbjct: 163 YYRWYICMTYFGGYTYQTLNWVLGSYPPQNPSCQKVDIQRVFA 205 >ref|XP_008082695.1| hypothetical protein GLAREA_13025 [Glarea lozoyensis ATCC 20868] gi|512201473|gb|EPE30302.1| hypothetical protein GLAREA_13025 [Glarea lozoyensis ATCC 20868] Length = 196 Score = 63.5 bits (153), Expect = 5e-08 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -1 Query: 244 YRWYICETYVGYQYTTLAWTYGKADPQNPTCQKVNVKR 131 +RW +C+TY GY Y TLAWT G PQNPTCQKV+V R Sbjct: 156 FRWQVCKTYYGYPYQTLAWTLGNHSPQNPTCQKVDVVR 193 >gb|KGQ06244.1| hypothetical protein BBAD15_g8436 [Beauveria bassiana D1-5] Length = 188 Score = 62.8 bits (151), Expect = 9e-08 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Frame = -1 Query: 238 WYICETY-VGYQYTTLAWTYGKADPQNPTCQKVNVKR 131 WYIC TY GY+Y TL+W YGKA PQNPTC KV+V+R Sbjct: 149 WYICNTYFTGYRYKTLSWVYGKAGPQNPTCVKVSVRR 185 >ref|XP_007297095.1| hypothetical protein MBM_09206 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406859573|gb|EKD12637.1| hypothetical protein MBM_09206 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 214 Score = 62.8 bits (151), Expect = 9e-08 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = -1 Query: 244 YRWYICETYVGYQYTTLAWTYGKADPQNPTCQKVNVKRVW 125 YRWY C T GY Y TLAW G PQNPTC+KV VKRV+ Sbjct: 174 YRWYACLTNAGYVYETLAWVVGTCKPQNPTCEKVTVKRVF 213 >ref|XP_008601187.1| hypothetical protein BBA_07868 [Beauveria bassiana ARSEF 2860] gi|400595467|gb|EJP63268.1| hypothetical protein BBA_07868 [Beauveria bassiana ARSEF 2860] Length = 188 Score = 62.8 bits (151), Expect = 9e-08 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Frame = -1 Query: 238 WYICETY-VGYQYTTLAWTYGKADPQNPTCQKVNVKR 131 WYIC TY GY+Y TL+W YGKA PQNPTC KV+V+R Sbjct: 149 WYICNTYFTGYRYKTLSWVYGKAGPQNPTCVKVSVRR 185 >gb|ESZ90221.1| hypothetical protein SBOR_9391 [Sclerotinia borealis F-4157] Length = 213 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -1 Query: 247 YYRWYICETYVGYQYTTLAWTYGKADPQNPTCQKVNVKR 131 YYRW IC+TY GY YTTLAW G+ PQNP+C+ V V R Sbjct: 162 YYRWAICDTYWGYAYTTLAWIVGEGAPQNPSCKSVRVYR 200 >ref|XP_001796562.1| hypothetical protein SNOG_06180 [Phaeosphaeria nodorum SN15] gi|111064891|gb|EAT86011.1| hypothetical protein SNOG_06180 [Phaeosphaeria nodorum SN15] Length = 206 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/40 (62%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Frame = -1 Query: 241 RWYICETY-VGYQYTTLAWTYGKADPQNPTCQKVNVKRVW 125 RWY C+TY GYQYT L W G P+NPTC KV+VKRV+ Sbjct: 166 RWYACQTYYAGYQYTNLVWGLGAGKPENPTCLKVDVKRVF 205 >gb|KHN97417.1| hypothetical protein MAM_04432 [Metarhizium album ARSEF 1941] Length = 193 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/38 (63%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = -1 Query: 241 RWYICETY-VGYQYTTLAWTYGKADPQNPTCQKVNVKR 131 RWY+C TY +GY Y TL W G A+PQNP+C VNVKR Sbjct: 153 RWYVCTTYNMGYTYQTLTWVLGNANPQNPSCASVNVKR 190 >gb|EME45809.1| hypothetical protein DOTSEDRAFT_71487 [Dothistroma septosporum NZE10] Length = 200 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = -1 Query: 247 YYRWYICET-YVGYQYTTLAWTYGKADPQNPTCQKVNVKRVWA 122 YYRWY+C++ Y G QY+TL W GK PQNP+C+KV V R +A Sbjct: 158 YYRWYVCKSNYEGTQYSTLNWVAGKYPPQNPSCEKVEVVRKFA 200 >ref|XP_007822816.1| hypothetical protein MAA_06627 [Metarhizium robertsii ARSEF 23] gi|322706263|gb|EFY97844.1| hypothetical protein MAA_06627 [Metarhizium robertsii ARSEF 23] gi|594717514|gb|EXV00412.1| hypothetical protein X797_006472 [Metarhizium robertsii] Length = 195 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/38 (65%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = -1 Query: 241 RWYICETY-VGYQYTTLAWTYGKADPQNPTCQKVNVKR 131 RWY+C TY VGY Y TL W G A+PQNP+C KV+VKR Sbjct: 153 RWYVCTTYNVGYTYQTLTWVLGGANPQNPSCVKVDVKR 190 >ref|XP_006672895.1| hypothetical protein CCM_07692 [Cordyceps militaris CM01] gi|346319839|gb|EGX89440.1| hypothetical protein CCM_07692 [Cordyceps militaris CM01] Length = 190 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/40 (57%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = -1 Query: 247 YYRWYICETYVG-YQYTTLAWTYGKADPQNPTCQKVNVKR 131 + RW+IC++Y Y+Y TL+W YG A PQNPTC KV+V+R Sbjct: 146 FQRWFICDSYYSSYRYKTLSWVYGNAPPQNPTCVKVSVQR 185 >ref|XP_007815623.1| hypothetical protein MAC_09283 [Metarhizium acridum CQMa 102] gi|322692804|gb|EFY84693.1| hypothetical protein MAC_09283 [Metarhizium acridum CQMa 102] Length = 193 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = -1 Query: 241 RWYICETY-VGYQYTTLAWTYGKADPQNPTCQKVNVKR 131 RWY+C TY Y Y TL W G A+PQNP+C KVNVKR Sbjct: 153 RWYVCTTYNFSYTYQTLTWVLGNANPQNPSCVKVNVKR 190 >ref|XP_007689641.1| hypothetical protein COCMIDRAFT_38275 [Bipolaris oryzae ATCC 44560] gi|576930254|gb|EUC43840.1| hypothetical protein COCMIDRAFT_38275 [Bipolaris oryzae ATCC 44560] Length = 211 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/42 (54%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = -1 Query: 247 YYRWYICETYVG-YQYTTLAWTYGKADPQNPTCQKVNVKRVW 125 +YRWY CET+ G Y Y LAW G P+NP+C VNV RV+ Sbjct: 169 FYRWYACETFYGSYNYKNLAWNLGSGKPENPSCVAVNVTRVF 210 >gb|EMD93241.1| hypothetical protein COCHEDRAFT_1223017 [Bipolaris maydis C5] gi|477590236|gb|ENI07311.1| hypothetical protein COCC4DRAFT_59131 [Bipolaris maydis ATCC 48331] Length = 211 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/42 (54%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = -1 Query: 247 YYRWYICETYVG-YQYTTLAWTYGKADPQNPTCQKVNVKRVW 125 +YRWY CET+ G Y Y LAW G P+NP+C VNV RV+ Sbjct: 169 FYRWYACETFYGSYNYKNLAWNLGSGKPENPSCVAVNVTRVF 210