BLASTX nr result
ID: Forsythia21_contig00028473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00028473 (231 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008084021.1| Ribosomal proteins S24e, L23 and L15e [Glare... 101 2e-19 ref|XP_007294929.1| 60S ribosomal protein L25 [Marssonina brunne... 101 2e-19 ref|XP_012739361.1| large subunit ribosomal protein L23Ae [Pseud... 97 3e-18 ref|XP_007912405.1| putative 60s ribosomal protein l25 protein [... 97 6e-18 ref|XP_007781862.1| large subunit ribosomal protein L23Ae [Conio... 96 7e-18 ref|XP_008717630.1| hypothetical protein HMPREF1541_05067 [Cyphe... 96 9e-18 emb|CCU77382.1| putative 60S ribosomal protein L23a [Blumeria gr... 96 1e-17 gb|KLJ10436.1| large subunit ribosomal protein L23Ae [Emmonsia p... 95 2e-17 gb|KFX99712.1| hypothetical protein V490_01698 [Pseudogymnoascus... 95 2e-17 gb|EPQ63194.1| hypothetical protein BGT96224_4423 [Blumeria gram... 95 2e-17 ref|XP_002790848.1| 60S ribosomal protein L25 [Paracoccidioides ... 94 3e-17 gb|EEH10523.1| 60S ribosomal protein L23 [Histoplasma capsulatum... 94 3e-17 ref|XP_963077.1| 60S ribosomal protein L25 [Neurospora crassa OR... 94 3e-17 ref|XP_007588330.1| putative 60s ribosomal protein l25 protein [... 94 3e-17 gb|EER40835.1| 60S ribosomal protein L23 [Histoplasma capsulatum... 94 3e-17 gb|KKY18617.1| putative 60s ribosomal protein l25 [Diplodia seri... 94 4e-17 ref|XP_003069685.1| 60S ribosomal protein L25 [Coccidioides posa... 94 4e-17 gb|EEQ90207.1| ribosomal protein L23a [Blastomyces dermatitidis ... 94 4e-17 gb|KKZ60651.1| large subunit ribosomal protein L23Ae [Emmonsia c... 94 5e-17 ref|XP_001597937.1| 60S ribosomal protein L25 [Sclerotinia scler... 93 6e-17 >ref|XP_008084021.1| Ribosomal proteins S24e, L23 and L15e [Glarea lozoyensis ATCC 20868] gi|512201080|gb|EPE29912.1| Ribosomal proteins S24e, L23 and L15e [Glarea lozoyensis ATCC 20868] Length = 156 Score = 101 bits (252), Expect = 2e-19 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GV+SHKVRKVR STTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKV++H Sbjct: 28 LKGVHSHKVRKVRKSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVIIH 78 >ref|XP_007294929.1| 60S ribosomal protein L25 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406861776|gb|EKD14829.1| 60S ribosomal protein L25 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 168 Score = 101 bits (252), Expect = 2e-19 Identities = 45/51 (88%), Positives = 51/51 (100%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GV+SHKVRKVRLSTTFHRPKTLQLSR+PKYPRKSVPH+PRLDEHKV++H Sbjct: 40 LKGVHSHKVRKVRLSTTFHRPKTLQLSRAPKYPRKSVPHEPRLDEHKVIIH 90 >ref|XP_012739361.1| large subunit ribosomal protein L23Ae [Pseudogymnoascus destructans 20631-21] gi|440632254|gb|ELR02173.1| large subunit ribosomal protein L23Ae [Pseudogymnoascus destructans 20631-21] gi|682301054|gb|KFY13051.1| hypothetical protein V491_06547 [Pseudogymnoascus pannorum VKM F-3775] gi|682307831|gb|KFY16986.1| hypothetical protein V492_00995 [Pseudogymnoascus pannorum VKM F-4246] gi|682318056|gb|KFY22415.1| hypothetical protein V493_06600 [Pseudogymnoascus pannorum VKM F-4281 (FW-2241)] gi|682348824|gb|KFY41112.1| hypothetical protein V494_03217 [Pseudogymnoascus pannorum VKM F-4513 (FW-928)] gi|682386647|gb|KFY68468.1| hypothetical protein V496_01090 [Pseudogymnoascus pannorum VKM F-4515 (FW-2607)] gi|682400220|gb|KFY77311.1| hypothetical protein V499_03294 [Pseudogymnoascus pannorum VKM F-103] gi|682424216|gb|KFY92338.1| hypothetical protein V500_04216 [Pseudogymnoascus pannorum VKM F-4518 (FW-2643)] gi|682430503|gb|KFY96559.1| hypothetical protein V498_02593 [Pseudogymnoascus pannorum VKM F-4517 (FW-2822)] gi|682445282|gb|KFZ06380.1| hypothetical protein V501_07477 [Pseudogymnoascus pannorum VKM F-4519 (FW-2642)] gi|682447506|gb|KFZ07786.1| hypothetical protein V502_09732 [Pseudogymnoascus pannorum VKM F-4520 (FW-2644)] Length = 156 Score = 97.4 bits (241), Expect = 3e-18 Identities = 43/51 (84%), Positives = 49/51 (96%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GV+SHK RKVRLSTTFHRPKTL LSRSPKYPRKS+PHQPRLDEH+V++H Sbjct: 28 LKGVHSHKARKVRLSTTFHRPKTLILSRSPKYPRKSIPHQPRLDEHQVIIH 78 >ref|XP_007912405.1| putative 60s ribosomal protein l25 protein [Togninia minima UCRPA7] gi|500260146|gb|EOO02849.1| putative 60s ribosomal protein l25 protein [Togninia minima UCRPA7] Length = 156 Score = 96.7 bits (239), Expect = 6e-18 Identities = 41/51 (80%), Positives = 50/51 (98%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GV+SHK RKVRL+T+FHRPKTLQLSR+PKYPRKSVPH+PRLDEHK+++H Sbjct: 28 LKGVHSHKARKVRLTTSFHRPKTLQLSRAPKYPRKSVPHEPRLDEHKIIVH 78 >ref|XP_007781862.1| large subunit ribosomal protein L23Ae [Coniosporium apollinis CBS 100218] gi|494829976|gb|EON66545.1| large subunit ribosomal protein L23Ae [Coniosporium apollinis CBS 100218] Length = 157 Score = 96.3 bits (238), Expect = 7e-18 Identities = 41/51 (80%), Positives = 50/51 (98%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GVNS KVRKVRLST+FHRPKTLQLSRSPKYPRK++PH+PRLD+HK+++H Sbjct: 29 LKGVNSSKVRKVRLSTSFHRPKTLQLSRSPKYPRKAIPHEPRLDQHKIIVH 79 >ref|XP_008717630.1| hypothetical protein HMPREF1541_05067 [Cyphellophora europaea CBS 101466] gi|568118171|gb|ETN40787.1| hypothetical protein HMPREF1541_05067 [Cyphellophora europaea CBS 101466] Length = 155 Score = 95.9 bits (237), Expect = 9e-18 Identities = 42/51 (82%), Positives = 48/51 (94%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 LRGVN++K RK+R STTFHRPKTLQLSRSPKYPRKSVPH+PRLD HKV++H Sbjct: 27 LRGVNANKARKIRTSTTFHRPKTLQLSRSPKYPRKSVPHEPRLDHHKVIVH 77 >emb|CCU77382.1| putative 60S ribosomal protein L23a [Blumeria graminis f. sp. hordei DH14] Length = 150 Score = 95.5 bits (236), Expect = 1e-17 Identities = 42/51 (82%), Positives = 50/51 (98%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GV+S+KVRKVR +TTFHRPKTL+LSRSPKYPRKS+PHQPRLDEHKV++H Sbjct: 26 LKGVHSNKVRKVRNTTTFHRPKTLRLSRSPKYPRKSIPHQPRLDEHKVIIH 76 >gb|KLJ10436.1| large subunit ribosomal protein L23Ae [Emmonsia parva UAMH 139] Length = 153 Score = 94.7 bits (234), Expect = 2e-17 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GV+SHKVRKVR STTFHRPKTLQLSRSPKYPRKS+PH+ RLD HK+++H Sbjct: 25 LKGVHSHKVRKVRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDHHKIIVH 75 >gb|KFX99712.1| hypothetical protein V490_01698 [Pseudogymnoascus pannorum VKM F-3557] gi|682283864|gb|KFY04342.1| hypothetical protein O988_00842 [Pseudogymnoascus pannorum VKM F-3808] gi|682350184|gb|KFY42037.1| hypothetical protein V495_04692 [Pseudogymnoascus pannorum VKM F-4514 (FW-929)] gi|682382242|gb|KFY64977.1| hypothetical protein V497_01527 [Pseudogymnoascus pannorum VKM F-4516 (FW-969)] Length = 156 Score = 94.7 bits (234), Expect = 2e-17 Identities = 42/51 (82%), Positives = 48/51 (94%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GV+SHK RKVR STTFHRPKTL LSRSPKYPRKS+PHQPRLDEH+V++H Sbjct: 28 LKGVHSHKARKVRNSTTFHRPKTLILSRSPKYPRKSIPHQPRLDEHQVIIH 78 >gb|EPQ63194.1| hypothetical protein BGT96224_4423 [Blumeria graminis f. sp. tritici 96224] Length = 150 Score = 94.7 bits (234), Expect = 2e-17 Identities = 42/51 (82%), Positives = 49/51 (96%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GV+S KVRKVR +TTFHRPKTL+LSRSPKYPRKS+PHQPRLDEHKV++H Sbjct: 26 LKGVHSSKVRKVRNTTTFHRPKTLRLSRSPKYPRKSIPHQPRLDEHKVIIH 76 >ref|XP_002790848.1| 60S ribosomal protein L25 [Paracoccidioides sp. 'lutzii' Pb01] Length = 153 Score = 94.4 bits (233), Expect = 3e-17 Identities = 39/51 (76%), Positives = 49/51 (96%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GV++HKVRK+R STTFHRPKTLQLSRSPKYPRKS+PH+ RLD+HK+++H Sbjct: 25 LKGVHAHKVRKIRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDQHKIIIH 75 >gb|EEH10523.1| 60S ribosomal protein L23 [Histoplasma capsulatum G186AR] Length = 153 Score = 94.4 bits (233), Expect = 3e-17 Identities = 40/51 (78%), Positives = 48/51 (94%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GV+SHKVRK+R STTFHRPKTLQLSRSPKYPRKS+PH+ RLD HK+++H Sbjct: 25 LKGVHSHKVRKIRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDHHKIIVH 75 >ref|XP_963077.1| 60S ribosomal protein L25 [Neurospora crassa OR74A] gi|698987498|ref|XP_009850730.1| 60S ribosomal protein L25 [Neurospora tetrasperma FGSC 2508] gi|28924728|gb|EAA33841.1| 60S ribosomal protein L25 [Neurospora crassa OR74A] gi|336469469|gb|EGO57631.1| 60S ribosomal protein L25 [Neurospora tetrasperma FGSC 2508] gi|350290887|gb|EGZ72101.1| 60S ribosomal protein L25 [Neurospora tetrasperma FGSC 2509] gi|725984072|gb|KHE87059.1| 60S ribosomal protein L25 [Neurospora crassa] Length = 156 Score = 94.4 bits (233), Expect = 3e-17 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GV+SHK KVR STTFHRPKTLQLSR+PKYPRKS+PH+PRLDEHKV++H Sbjct: 28 LKGVHSHKKTKVRYSTTFHRPKTLQLSRAPKYPRKSIPHEPRLDEHKVIVH 78 >ref|XP_007588330.1| putative 60s ribosomal protein l25 protein [Neofusicoccum parvum UCRNP2] gi|485917148|gb|EOD44201.1| putative 60s ribosomal protein l25 protein [Neofusicoccum parvum UCRNP2] Length = 150 Score = 94.4 bits (233), Expect = 3e-17 Identities = 42/51 (82%), Positives = 48/51 (94%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GVNSHKVRKVR STTFHRPKTLQLSR+PKYPRKS+PH+PRLD KV++H Sbjct: 22 LKGVNSHKVRKVRNSTTFHRPKTLQLSRAPKYPRKSIPHEPRLDASKVIVH 72 >gb|EER40835.1| 60S ribosomal protein L23 [Histoplasma capsulatum H143] gi|325091756|gb|EGC45066.1| 60S ribosomal protein [Histoplasma capsulatum H88] Length = 153 Score = 94.4 bits (233), Expect = 3e-17 Identities = 40/51 (78%), Positives = 48/51 (94%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GV+SHKVRK+R STTFHRPKTLQLSRSPKYPRKS+PH+ RLD HK+++H Sbjct: 25 LKGVHSHKVRKIRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDHHKIIVH 75 >gb|KKY18617.1| putative 60s ribosomal protein l25 [Diplodia seriata] Length = 150 Score = 94.0 bits (232), Expect = 4e-17 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GVNSHKVRKVR STTFHRPKTLQLSR+PKYPR S+PHQPRLD KV++H Sbjct: 22 LKGVNSHKVRKVRKSTTFHRPKTLQLSRAPKYPRTSIPHQPRLDASKVIIH 72 >ref|XP_003069685.1| 60S ribosomal protein L25 [Coccidioides posadasii C735 delta SOWgp] gi|815884715|ref|XP_001242474.2| 60S ribosomal protein L25 [Coccidioides immitis RS] gi|240109371|gb|EER27540.1| 60S ribosomal protein L23a, putative [Coccidioides posadasii C735 delta SOWgp] gi|767017251|gb|EAS30891.3| 60S ribosomal protein L25 [Coccidioides immitis RS] gi|875635349|gb|KMU82971.1| 60S ribosomal protein L23a [Coccidioides immitis H538.4] Length = 152 Score = 94.0 bits (232), Expect = 4e-17 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GV+SHKV+KVR STTFHRPKTLQLSRSPKYPRKS+PH+ RLD HKV++H Sbjct: 24 LKGVHSHKVKKVRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDHHKVIVH 74 >gb|EEQ90207.1| ribosomal protein L23a [Blastomyces dermatitidis ER-3] gi|327357503|gb|EGE86360.1| 60S ribosomal protein L23 [Blastomyces dermatitidis ATCC 18188] gi|531978513|gb|EQL29100.1| large subunit ribosomal protein L23Ae [Blastomyces dermatitidis ATCC 26199] Length = 153 Score = 94.0 bits (232), Expect = 4e-17 Identities = 40/51 (78%), Positives = 48/51 (94%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GV+SHKVRKVR STTFHRPKTLQLSRSPKYPRKS+PH+ RLD H++++H Sbjct: 25 LKGVHSHKVRKVRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDHHRIIIH 75 >gb|KKZ60651.1| large subunit ribosomal protein L23Ae [Emmonsia crescens UAMH 3008] Length = 154 Score = 93.6 bits (231), Expect = 5e-17 Identities = 40/51 (78%), Positives = 48/51 (94%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GV++HKVRK+R STTFHRPKTLQLSRSPKYPRKS+PH+ RLD HKV++H Sbjct: 26 LKGVHAHKVRKIRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDHHKVIVH 76 >ref|XP_001597937.1| 60S ribosomal protein L25 [Sclerotinia sclerotiorum 1980 UF-70] gi|154690885|gb|EDN90623.1| 60S ribosomal protein L25 [Sclerotinia sclerotiorum 1980 UF-70] Length = 154 Score = 93.2 bits (230), Expect = 6e-17 Identities = 42/51 (82%), Positives = 48/51 (94%) Frame = -1 Query: 153 LRGVNSHKVRKVRLSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVVLH 1 L+GV+SHKVRKVRLSTTFHRPKTLQLSR+PKYPR S+ QPRLDEHKV++H Sbjct: 26 LKGVHSHKVRKVRLSTTFHRPKTLQLSRAPKYPRTSIVSQPRLDEHKVIIH 76