BLASTX nr result
ID: Forsythia21_contig00027342
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00027342 (427 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073618.1| PREDICTED: protein SPA1-RELATED 2-like [Sesa... 68 2e-09 >ref|XP_011073618.1| PREDICTED: protein SPA1-RELATED 2-like [Sesamum indicum] Length = 1064 Score = 68.2 bits (165), Expect = 2e-09 Identities = 35/54 (64%), Positives = 42/54 (77%) Frame = +2 Query: 266 RSKDCEFSLKPGSSSMLEPNEMVMPCKDGYHENSNYLVSDTLDAKNLDRIGSSE 427 R+K+ EFSLKPGSSSML+ NEM+ P + Y ENS SD L+AK+LDRIGSSE Sbjct: 19 RNKENEFSLKPGSSSMLQSNEMITPGVNDYPENSKNGYSDILEAKDLDRIGSSE 72