BLASTX nr result
ID: Forsythia21_contig00027162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00027162 (401 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ85751.1| hypothetical protein M438DRAFT_293627 [Aureobasid... 59 2e-06 ref|XP_007680418.1| hypothetical protein BAUCODRAFT_38535 [Baudo... 56 8e-06 >gb|KEQ85751.1| hypothetical protein M438DRAFT_293627 [Aureobasidium pullulans EXF-150] Length = 902 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/37 (81%), Positives = 34/37 (91%), Gaps = 1/37 (2%) Frame = -3 Query: 357 DDLEVLSADEVE-SNDGFLTDEEYDILDASDQETVTS 250 DDLEVLSA+E E S+DGFLTD++YDILDASDQETV S Sbjct: 864 DDLEVLSANEEETSDDGFLTDDDYDILDASDQETVAS 900 >ref|XP_007680418.1| hypothetical protein BAUCODRAFT_38535 [Baudoinia compniacensis UAMH 10762] gi|449296448|gb|EMC92468.1| hypothetical protein BAUCODRAFT_38535 [Baudoinia compniacensis UAMH 10762] Length = 1017 Score = 56.2 bits (134), Expect = 8e-06 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 3/42 (7%) Frame = -3 Query: 363 DFDDLEVLSA--DEV-ESNDGFLTDEEYDILDASDQETVTSK 247 DF+++EVLSA D V E +DGFLTDEEYDILDASD ETV SK Sbjct: 976 DFEEVEVLSASGDMVSEDDDGFLTDEEYDILDASDHETVASK 1017