BLASTX nr result
ID: Forsythia21_contig00027081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00027081 (224 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012841829.1| PREDICTED: farnesyl pyrophosphate synthase-l... 75 2e-11 gb|AKN52395.1| farnesyl diphosphate synthase [Panax japonicus] 74 4e-11 gb|AAY87903.1| farnesyl diphosphate synthase [Panax ginseng] 74 4e-11 gb|AGS79228.1| farnesyl diphosphate synthase [Panax notoginseng]... 74 4e-11 gb|AFO67222.1| putative farnesyl diphosphate synthase, partial [... 74 4e-11 gb|ADJ68004.1| farnesyl diphosphate synthase [Panax quinquefoliu... 74 4e-11 gb|ADK12004.1| farnesyl diphosphate synthase [Aralia elata] 74 4e-11 gb|AAY53905.1| farnesyl pyrophosphate synthase [Panax notoginseng] 74 4e-11 dbj|BAB40665.1| farnesyl pyrophosphate synthase [Humulus lupulus... 74 5e-11 emb|CDP13684.1| unnamed protein product [Coffea canephora] 73 8e-11 ref|XP_008218685.1| PREDICTED: farnesyl pyrophosphate synthase 1... 73 8e-11 ref|NP_001267864.1| farnesyl diphosphate synthase [Vitis vinifer... 73 8e-11 ref|XP_007205488.1| hypothetical protein PRUPE_ppa008174mg [Prun... 73 8e-11 ref|XP_007205487.1| hypothetical protein PRUPE_ppa008174mg [Prun... 73 8e-11 emb|CBI39786.3| unnamed protein product [Vitis vinifera] 73 8e-11 gb|AAV58896.1| farnesyl diphosphate synthase [Centella asiatica] 73 8e-11 gb|AGJ03663.1| putative farnesyl diphosphate synthase 2 [Eucommi... 72 1e-10 dbj|BAB60822.1| putative FPP synthase 2 [Eucommia ulmoides] 72 1e-10 gb|AEG47693.1| farnesyl diphosphate synthase [Allium sativum] 72 2e-10 ref|XP_009594047.1| PREDICTED: farnesyl pyrophosphate synthase 1... 71 2e-10 >ref|XP_012841829.1| PREDICTED: farnesyl pyrophosphate synthase-like [Erythranthe guttatus] gi|604328053|gb|EYU33721.1| hypothetical protein MIMGU_mgv1a008270mg [Erythranthe guttata] Length = 379 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/52 (71%), Positives = 43/52 (82%), Gaps = 6/52 (11%) Frame = -3 Query: 138 HTISLS------LETMSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 HT++ S L TM+DL+SKFL+VYSVLKSELLNDP FEFTDDSRQW+ER Sbjct: 23 HTVTHSPPLLRPLSTMADLKSKFLQVYSVLKSELLNDPNFEFTDDSRQWIER 74 >gb|AKN52395.1| farnesyl diphosphate synthase [Panax japonicus] Length = 342 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MSDL+++FLEVYSVLKSELLNDPAFEFTDDSRQWVER Sbjct: 1 MSDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVER 37 >gb|AAY87903.1| farnesyl diphosphate synthase [Panax ginseng] Length = 342 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MSDL+++FLEVYSVLKSELLNDPAFEFTDDSRQWVER Sbjct: 1 MSDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVER 37 >gb|AGS79228.1| farnesyl diphosphate synthase [Panax notoginseng] gi|672930589|gb|AIK21789.1| farnesyl diphosphate synthase [Panax notoginseng] Length = 342 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MSDL+++FLEVYSVLKSELLNDPAFEFTDDSRQWVER Sbjct: 1 MSDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVER 37 >gb|AFO67222.1| putative farnesyl diphosphate synthase, partial [Aralia elata] Length = 245 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MSDL+++FLEVYSVLKSELLNDPAFEFTDDSRQWVER Sbjct: 1 MSDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVER 37 >gb|ADJ68004.1| farnesyl diphosphate synthase [Panax quinquefolius] gi|484847891|gb|AGK62445.1| farnesyl diphosphate synthase [Panax quinquefolius] Length = 342 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MSDL+++FLEVYSVLKSELLNDPAFEFTDDSRQWVER Sbjct: 1 MSDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVER 37 >gb|ADK12004.1| farnesyl diphosphate synthase [Aralia elata] Length = 342 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MSDL+++FLEVYSVLKSELLNDPAFEFTDDSRQWVER Sbjct: 1 MSDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVER 37 >gb|AAY53905.1| farnesyl pyrophosphate synthase [Panax notoginseng] Length = 343 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MSDL+++FLEVYSVLKSELLNDPAFEFTDDSRQWVER Sbjct: 1 MSDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVER 37 >dbj|BAB40665.1| farnesyl pyrophosphate synthase [Humulus lupulus] gi|13537423|dbj|BAB40666.1| farnesyl pyrophophate synthase [Humulus lupulus] Length = 342 Score = 73.6 bits (179), Expect = 5e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MS LRSKF+EVYS+LKSELLNDPAFEFTDDSRQWVER Sbjct: 1 MSGLRSKFMEVYSILKSELLNDPAFEFTDDSRQWVER 37 >emb|CDP13684.1| unnamed protein product [Coffea canephora] Length = 342 Score = 72.8 bits (177), Expect = 8e-11 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MSDL++KFLEVYSVLKSELLNDPAFEFTDDSRQW++R Sbjct: 1 MSDLKTKFLEVYSVLKSELLNDPAFEFTDDSRQWLDR 37 >ref|XP_008218685.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Prunus mume] Length = 342 Score = 72.8 bits (177), Expect = 8e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MSDLRSKFLEVYSVLKSELLNDPAFEFTD SRQWV+R Sbjct: 1 MSDLRSKFLEVYSVLKSELLNDPAFEFTDVSRQWVDR 37 >ref|NP_001267864.1| farnesyl diphosphate synthase [Vitis vinifera] gi|62199628|gb|AAX76910.1| farnesyl diphosphate synthase [Vitis vinifera] Length = 341 Score = 72.8 bits (177), Expect = 8e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MS+ +SKFLEVYSVLKSELLNDPAFEFTDDSRQWVER Sbjct: 1 MSETKSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 37 >ref|XP_007205488.1| hypothetical protein PRUPE_ppa008174mg [Prunus persica] gi|462401130|gb|EMJ06687.1| hypothetical protein PRUPE_ppa008174mg [Prunus persica] Length = 342 Score = 72.8 bits (177), Expect = 8e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MSDLRSKFLEVYSVLKSELLNDPAFEFTD SRQWV+R Sbjct: 1 MSDLRSKFLEVYSVLKSELLNDPAFEFTDVSRQWVDR 37 >ref|XP_007205487.1| hypothetical protein PRUPE_ppa008174mg [Prunus persica] gi|462401129|gb|EMJ06686.1| hypothetical protein PRUPE_ppa008174mg [Prunus persica] Length = 274 Score = 72.8 bits (177), Expect = 8e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MSDLRSKFLEVYSVLKSELLNDPAFEFTD SRQWV+R Sbjct: 1 MSDLRSKFLEVYSVLKSELLNDPAFEFTDVSRQWVDR 37 >emb|CBI39786.3| unnamed protein product [Vitis vinifera] Length = 341 Score = 72.8 bits (177), Expect = 8e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MS+ +SKFLEVYSVLKSELLNDPAFEFTDDSRQWVER Sbjct: 1 MSETKSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 37 >gb|AAV58896.1| farnesyl diphosphate synthase [Centella asiatica] Length = 342 Score = 72.8 bits (177), Expect = 8e-11 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MSDL+++FLEVYSVLKS+LLNDPAFEFTDDSRQWVER Sbjct: 1 MSDLKTRFLEVYSVLKSDLLNDPAFEFTDDSRQWVER 37 >gb|AGJ03663.1| putative farnesyl diphosphate synthase 2 [Eucommia ulmoides] Length = 342 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MSDL+SKFLEVYSVLKSELLNDPAF+FTDDSR WVER Sbjct: 1 MSDLKSKFLEVYSVLKSELLNDPAFDFTDDSRLWVER 37 >dbj|BAB60822.1| putative FPP synthase 2 [Eucommia ulmoides] Length = 342 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MSDL+SKFLEVYSVLKSELLNDPAF+FTDDSR WVER Sbjct: 1 MSDLKSKFLEVYSVLKSELLNDPAFDFTDDSRLWVER 37 >gb|AEG47693.1| farnesyl diphosphate synthase [Allium sativum] Length = 341 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MS+ ++KFLEVYSVLKSELLNDPAFEFTDDSRQWVER Sbjct: 1 MSETKAKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 37 >ref|XP_009594047.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Nicotiana tomentosiformis] Length = 342 Score = 71.2 bits (173), Expect = 2e-10 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 111 MSDLRSKFLEVYSVLKSELLNDPAFEFTDDSRQWVER 1 MSDL+SKFLEVYSVLKSELLNDP FEFTD++RQWVER Sbjct: 1 MSDLKSKFLEVYSVLKSELLNDPDFEFTDEARQWVER 37