BLASTX nr result
ID: Forsythia21_contig00026648
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00026648 (211 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094425.1| PREDICTED: pentatricopeptide repeat-containi... 64 5e-08 >ref|XP_011094425.1| PREDICTED: pentatricopeptide repeat-containing protein At5g12100, mitochondrial [Sesamum indicum] Length = 796 Score = 63.5 bits (153), Expect = 5e-08 Identities = 35/65 (53%), Positives = 45/65 (69%) Frame = -2 Query: 195 RFFHHVLPSKFHVPIFQNSQSSLSVKSLCFASSFADPTTQTRLQEEIRKVQILLQQNRTE 16 R H +LPSKF +S+ S KS C ASS DPTTQ +L EE+RK+++L+QQNR+E Sbjct: 3 RHCHRLLPSKF--------RSTPSPKSFC-ASSAPDPTTQVQLLEELRKIRVLIQQNRSE 53 Query: 15 AAKRH 1 AKRH Sbjct: 54 TAKRH 58