BLASTX nr result
ID: Forsythia21_contig00026439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00026439 (343 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ75359.1| hypothetical protein M436DRAFT_41696 [Aureobasidi... 73 6e-11 gb|KER00089.1| hypothetical protein AUEXF2481DRAFT_55 [Aureobasi... 65 1e-08 gb|KEQ62419.1| hypothetical protein M437DRAFT_75580 [Aureobasidi... 59 2e-06 gb|KEQ81669.1| hypothetical protein M438DRAFT_376534 [Aureobasid... 58 2e-06 gb|KEQ57683.1| hypothetical protein M437DRAFT_29644, partial [Au... 58 3e-06 >gb|KEQ75359.1| hypothetical protein M436DRAFT_41696 [Aureobasidium namibiae CBS 147.97] Length = 352 Score = 73.2 bits (178), Expect = 6e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 341 GTTLSILASSTGGLSLSYFEDWNPSPIGLFITSC 240 GTTLSILASSTGGLSLSYFEDWNPSPIGLFITSC Sbjct: 319 GTTLSILASSTGGLSLSYFEDWNPSPIGLFITSC 352 >gb|KER00089.1| hypothetical protein AUEXF2481DRAFT_55 [Aureobasidium subglaciale EXF-2481] Length = 567 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 341 GTTLSILASSTGGLSLSYFEDWNPSPIGLFITSC 240 GTT+SILAS TGG+SL+YF+DWNPSPIG++ITSC Sbjct: 534 GTTMSILASGTGGMSLTYFQDWNPSPIGVYITSC 567 >gb|KEQ62419.1| hypothetical protein M437DRAFT_75580 [Aureobasidium melanogenum CBS 110374] Length = 489 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 341 GTTLSILASSTGGLSLSYFEDWNPSPIGLFITSC 240 G+T+SILAS+TG L+L FEDWNPS IGLFITSC Sbjct: 456 GSTISILASATGSLNLELFEDWNPSAIGLFITSC 489 >gb|KEQ81669.1| hypothetical protein M438DRAFT_376534 [Aureobasidium pullulans EXF-150] Length = 552 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 341 GTTLSILASSTGGLSLSYFEDWNPSPIGLFITSC 240 G+T+SI AS TG L L+YF+DWNPSPIG+FITSC Sbjct: 519 GSTVSIEASVTGSLGLTYFQDWNPSPIGVFITSC 552 >gb|KEQ57683.1| hypothetical protein M437DRAFT_29644, partial [Aureobasidium melanogenum CBS 110374] Length = 325 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 341 GTTLSILASSTGGLSLSYFEDWNPSPIGLFITSC 240 G+T+SILAS+TG L LS FEDW+PS IGLFITSC Sbjct: 292 GSTISILASATGSLELSLFEDWDPSAIGLFITSC 325