BLASTX nr result
ID: Forsythia21_contig00026416
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00026416 (208 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075332.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-15 emb|CDP14119.1| unnamed protein product [Coffea canephora] 77 4e-12 ref|XP_012828099.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-11 gb|EYU18728.1| hypothetical protein MIMGU_mgv1a003317mg [Erythra... 76 1e-11 ref|XP_012459746.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_009766339.1| PREDICTED: pentatricopeptide repeat-containi... 73 6e-11 ref|XP_009589364.1| PREDICTED: pentatricopeptide repeat-containi... 73 6e-11 ref|XP_007014350.1| Pentatricopeptide repeat (PPR) superfamily p... 72 1e-10 gb|KDO48200.1| hypothetical protein CISIN_1g047305mg, partial [C... 70 5e-10 ref|XP_012086185.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 gb|KDP26067.1| hypothetical protein JCGZ_21100 [Jatropha curcas] 69 9e-10 ref|XP_006492928.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_006421323.1| hypothetical protein CICLE_v10004347mg [Citr... 68 2e-09 ref|XP_009363299.1| PREDICTED: pentatricopeptide repeat-containi... 66 8e-09 ref|XP_008371947.1| PREDICTED: pentatricopeptide repeat-containi... 66 8e-09 ref|XP_002529510.1| pentatricopeptide repeat-containing protein,... 66 8e-09 emb|CBI29825.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_002278530.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_008225970.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 ref|XP_007213627.1| hypothetical protein PRUPE_ppa002066mg [Prun... 63 7e-08 >ref|XP_011075332.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Sesamum indicum] Length = 806 Score = 86.7 bits (213), Expect = 6e-15 Identities = 37/66 (56%), Positives = 56/66 (84%) Frame = -2 Query: 207 KGYQLLPRICNNMLQALLCSQEKSALAFELLSRMKSMGYNLNAYLQLRTKSLLHHHWNIR 28 KG++L+P +CN++L+ LL S++K+ LAFELL +MKSMGY+LN++L+ TKS LHHH+ +R Sbjct: 739 KGHRLMPPVCNSLLKVLLSSKDKAGLAFELLDKMKSMGYDLNSFLRRSTKSRLHHHYRMR 798 Query: 27 ETENMS 10 + EN+S Sbjct: 799 KRENVS 804 >emb|CDP14119.1| unnamed protein product [Coffea canephora] Length = 808 Score = 77.0 bits (188), Expect = 4e-12 Identities = 41/70 (58%), Positives = 51/70 (72%), Gaps = 2/70 (2%) Frame = -2 Query: 207 KGYQLLPRICNNMLQALLCSQEKSALAFELLSRMKSMGYNLNAYLQLRTKSLLHHH--WN 34 KG +L+PRICNN+L LL SQEK+ AF LL MKSMGYNL++YL TKSLL HH Sbjct: 739 KGIRLMPRICNNLLTMLLHSQEKAEDAFYLLKEMKSMGYNLDSYLYKNTKSLLIHHRYRK 798 Query: 33 IRETENMSTG 4 +R+ E++S G Sbjct: 799 VRKLESVSHG 808 >ref|XP_012828099.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Erythranthe guttatus] Length = 811 Score = 75.9 bits (185), Expect = 1e-11 Identities = 32/65 (49%), Positives = 52/65 (80%) Frame = -2 Query: 207 KGYQLLPRICNNMLQALLCSQEKSALAFELLSRMKSMGYNLNAYLQLRTKSLLHHHWNIR 28 +GY+L+PR+CN +LQ LL S+E++ +AFELL +MKS+GY+LN+ + T+ L+ H +N R Sbjct: 742 RGYKLMPRVCNGLLQRLLGSKERAVVAFELLDKMKSVGYDLNSCVHHNTRFLIRHRYNER 801 Query: 27 ETENM 13 ++EN+ Sbjct: 802 KSENV 806 >gb|EYU18728.1| hypothetical protein MIMGU_mgv1a003317mg [Erythranthe guttata] Length = 592 Score = 75.9 bits (185), Expect = 1e-11 Identities = 32/65 (49%), Positives = 52/65 (80%) Frame = -2 Query: 207 KGYQLLPRICNNMLQALLCSQEKSALAFELLSRMKSMGYNLNAYLQLRTKSLLHHHWNIR 28 +GY+L+PR+CN +LQ LL S+E++ +AFELL +MKS+GY+LN+ + T+ L+ H +N R Sbjct: 523 RGYKLMPRVCNGLLQRLLGSKERAVVAFELLDKMKSVGYDLNSCVHHNTRFLIRHRYNER 582 Query: 27 ETENM 13 ++EN+ Sbjct: 583 KSENV 587 >ref|XP_012459746.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Gossypium raimondii] Length = 800 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/68 (50%), Positives = 53/68 (77%) Frame = -2 Query: 207 KGYQLLPRICNNMLQALLCSQEKSALAFELLSRMKSMGYNLNAYLQLRTKSLLHHHWNIR 28 KG++L+PR+CN +L++LL S++K AF+LLS+M S Y+L+AYL TKSLL+ H + R Sbjct: 733 KGFKLMPRVCNYLLRSLLRSKDKRMYAFDLLSKMNSQRYDLDAYLHKTTKSLLYMHRHAR 792 Query: 27 ETENMSTG 4 ET++++ G Sbjct: 793 ETKSLAPG 800 >ref|XP_009766339.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana sylvestris] gi|698542253|ref|XP_009766340.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana sylvestris] gi|698542256|ref|XP_009766341.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana sylvestris] gi|698542259|ref|XP_009766343.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana sylvestris] gi|698542262|ref|XP_009766344.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana sylvestris] gi|698542265|ref|XP_009766345.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana sylvestris] Length = 789 Score = 73.2 bits (178), Expect = 6e-11 Identities = 37/68 (54%), Positives = 48/68 (70%) Frame = -2 Query: 207 KGYQLLPRICNNMLQALLCSQEKSALAFELLSRMKSMGYNLNAYLQLRTKSLLHHHWNIR 28 +G +L+PRICN +LQ LL SQ+K+ A +LL RM+S GYNLN YL T+SL WN R Sbjct: 723 RGVRLMPRICNRLLQTLLRSQDKAQHAVDLLERMRSTGYNLNDYLHSGTRSLF-QRWNRR 781 Query: 27 ETENMSTG 4 TE++S G Sbjct: 782 GTESLSPG 789 >ref|XP_009589364.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana tomentosiformis] gi|697161175|ref|XP_009589365.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana tomentosiformis] gi|697161177|ref|XP_009589366.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana tomentosiformis] gi|697161179|ref|XP_009589367.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana tomentosiformis] gi|697161181|ref|XP_009589368.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana tomentosiformis] Length = 803 Score = 73.2 bits (178), Expect = 6e-11 Identities = 37/68 (54%), Positives = 48/68 (70%) Frame = -2 Query: 207 KGYQLLPRICNNMLQALLCSQEKSALAFELLSRMKSMGYNLNAYLQLRTKSLLHHHWNIR 28 +G +L+PRICN +LQ LL SQ+K+ A +LL RM+S GYNLN YL T+SL WN R Sbjct: 737 RGVRLMPRICNRLLQTLLRSQDKAQHAVDLLERMRSTGYNLNDYLHSGTRSLF-QRWNRR 795 Query: 27 ETENMSTG 4 TE++S G Sbjct: 796 GTESLSPG 803 >ref|XP_007014350.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] gi|508784713|gb|EOY31969.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 800 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/68 (50%), Positives = 50/68 (73%) Frame = -2 Query: 207 KGYQLLPRICNNMLQALLCSQEKSALAFELLSRMKSMGYNLNAYLQLRTKSLLHHHWNIR 28 +G++L+PRICN +L++LL S++K AF LLS+M S Y+L+AYL TKSLL+ HW+ Sbjct: 733 QGFKLMPRICNYLLKSLLRSKDKRMHAFGLLSKMNSQRYDLDAYLHKTTKSLLYRHWHTW 792 Query: 27 ETENMSTG 4 + EN + G Sbjct: 793 KMENAAPG 800 >gb|KDO48200.1| hypothetical protein CISIN_1g047305mg, partial [Citrus sinensis] Length = 767 Score = 70.1 bits (170), Expect = 5e-10 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 1/68 (1%) Frame = -2 Query: 204 GYQLLPRICNNMLQALLCSQE-KSALAFELLSRMKSMGYNLNAYLQLRTKSLLHHHWNIR 28 G+ L PR+CN +L++LL S++ K A+ LL RMKS+GY+L+A L +TKSLL WN R Sbjct: 700 GFILRPRVCNYLLRSLLFSKDNKKVHAYHLLCRMKSVGYDLDACLYPKTKSLLPGPWNTR 759 Query: 27 ETENMSTG 4 E ENMS G Sbjct: 760 EMENMSPG 767 >ref|XP_012086185.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Jatropha curcas] Length = 931 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/50 (62%), Positives = 40/50 (80%) Frame = -2 Query: 207 KGYQLLPRICNNMLQALLCSQEKSALAFELLSRMKSMGYNLNAYLQLRTK 58 +GY L+PRICN +L+ LLCS++K A +LLSRMKS+GY+LNAYL TK Sbjct: 728 EGYMLMPRICNRLLKCLLCSEDKRYRALDLLSRMKSLGYDLNAYLHRTTK 777 >gb|KDP26067.1| hypothetical protein JCGZ_21100 [Jatropha curcas] Length = 499 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/50 (62%), Positives = 40/50 (80%) Frame = -2 Query: 207 KGYQLLPRICNNMLQALLCSQEKSALAFELLSRMKSMGYNLNAYLQLRTK 58 +GY L+PRICN +L+ LLCS++K A +LLSRMKS+GY+LNAYL TK Sbjct: 296 EGYMLMPRICNRLLKCLLCSEDKRYRALDLLSRMKSLGYDLNAYLHRTTK 345 >ref|XP_006492928.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Citrus sinensis] Length = 869 Score = 68.2 bits (165), Expect = 2e-09 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = -2 Query: 195 LLPRICNNMLQALLCSQE-KSALAFELLSRMKSMGYNLNAYLQLRTKSLLHHHWNIRETE 19 L PR+CN +L++LL S++ K A+ LL RMKS+GY+L+A L +TKSLL WN RE E Sbjct: 805 LRPRVCNYLLRSLLLSKDNKKVHAYHLLRRMKSVGYDLDACLYPKTKSLLPGPWNTREME 864 Query: 18 NMSTG 4 NMS G Sbjct: 865 NMSPG 869 >ref|XP_006421323.1| hypothetical protein CICLE_v10004347mg [Citrus clementina] gi|557523196|gb|ESR34563.1| hypothetical protein CICLE_v10004347mg [Citrus clementina] Length = 801 Score = 68.2 bits (165), Expect = 2e-09 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = -2 Query: 195 LLPRICNNMLQALLCSQE-KSALAFELLSRMKSMGYNLNAYLQLRTKSLLHHHWNIRETE 19 L PR+CN +L++LL S++ K A+ LL RMKS+GY+L+A L +TKSLL WN RE E Sbjct: 737 LRPRVCNYLLRSLLLSKDNKKVHAYHLLRRMKSVGYDLDACLYPKTKSLLPGPWNTREME 796 Query: 18 NMSTG 4 NMS G Sbjct: 797 NMSPG 801 >ref|XP_009363299.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Pyrus x bretschneideri] gi|694371512|ref|XP_009363300.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Pyrus x bretschneideri] gi|694371515|ref|XP_009363301.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Pyrus x bretschneideri] gi|694371519|ref|XP_009363302.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Pyrus x bretschneideri] gi|694371522|ref|XP_009363303.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Pyrus x bretschneideri] Length = 785 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/58 (53%), Positives = 43/58 (74%) Frame = -2 Query: 207 KGYQLLPRICNNMLQALLCSQEKSALAFELLSRMKSMGYNLNAYLQLRTKSLLHHHWN 34 KG+ L+P ICN +L+ LL SQ+K A +L+SRM+S+GY+L++YLQ TK LL H N Sbjct: 728 KGFMLMPEICNTLLKCLLRSQDKKDHALDLVSRMRSLGYDLDSYLQQTTKFLLQCHGN 785 >ref|XP_008371947.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Malus domestica] gi|657960736|ref|XP_008371948.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Malus domestica] gi|657960738|ref|XP_008371949.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Malus domestica] gi|657960740|ref|XP_008371951.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Malus domestica] Length = 785 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/58 (53%), Positives = 43/58 (74%) Frame = -2 Query: 207 KGYQLLPRICNNMLQALLCSQEKSALAFELLSRMKSMGYNLNAYLQLRTKSLLHHHWN 34 KG+ L+P ICN +L+ LL SQ+K A +L+SRM+S+GY+L++YLQ TK LL H N Sbjct: 728 KGFMLMPEICNTLLKCLLRSQDKKDHALDLVSRMRSLGYDLDSYLQQTTKFLLQCHGN 785 >ref|XP_002529510.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531026|gb|EEF32879.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 804 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/53 (58%), Positives = 43/53 (81%) Frame = -2 Query: 207 KGYQLLPRICNNMLQALLCSQEKSALAFELLSRMKSMGYNLNAYLQLRTKSLL 49 KGY L+PRICN +L++LL S++K AF+LLSRMKS+GY+L+++L TK LL Sbjct: 727 KGYMLMPRICNRLLKSLLRSEDKRNRAFDLLSRMKSLGYDLDSHLHQTTKFLL 779 >emb|CBI29825.3| unnamed protein product [Vitis vinifera] Length = 722 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/68 (47%), Positives = 46/68 (67%) Frame = -2 Query: 207 KGYQLLPRICNNMLQALLCSQEKSALAFELLSRMKSMGYNLNAYLQLRTKSLLHHHWNIR 28 KG+ L+PRICN +L++L+ Q+K A +LL+RM S GY+L+ YL R KS L W + Sbjct: 656 KGFMLMPRICNQLLRSLIL-QDKMKHALDLLNRMNSAGYDLDEYLHHRIKSYLLSVWKAQ 714 Query: 27 ETENMSTG 4 E EN++ G Sbjct: 715 EMENVAPG 722 >ref|XP_002278530.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Vitis vinifera] Length = 798 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/68 (47%), Positives = 46/68 (67%) Frame = -2 Query: 207 KGYQLLPRICNNMLQALLCSQEKSALAFELLSRMKSMGYNLNAYLQLRTKSLLHHHWNIR 28 KG+ L+PRICN +L++L+ Q+K A +LL+RM S GY+L+ YL R KS L W + Sbjct: 732 KGFMLMPRICNQLLRSLIL-QDKMKHALDLLNRMNSAGYDLDEYLHHRIKSYLLSVWKAQ 790 Query: 27 ETENMSTG 4 E EN++ G Sbjct: 791 EMENVAPG 798 >ref|XP_008225970.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Prunus mume] Length = 785 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/58 (51%), Positives = 40/58 (68%) Frame = -2 Query: 207 KGYQLLPRICNNMLQALLCSQEKSALAFELLSRMKSMGYNLNAYLQLRTKSLLHHHWN 34 KG+ L+P ICN +L+ LL SQ+K A +L+SRM+S GY+L+ YL TK LL H N Sbjct: 728 KGFMLMPEICNQLLKCLLRSQDKKDHALDLISRMRSFGYDLDFYLHQTTKFLLECHMN 785 >ref|XP_007213627.1| hypothetical protein PRUPE_ppa002066mg [Prunus persica] gi|462409492|gb|EMJ14826.1| hypothetical protein PRUPE_ppa002066mg [Prunus persica] Length = 722 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/58 (51%), Positives = 40/58 (68%) Frame = -2 Query: 207 KGYQLLPRICNNMLQALLCSQEKSALAFELLSRMKSMGYNLNAYLQLRTKSLLHHHWN 34 KG+ L+P ICN +L+ LL SQ+K A +L+SRM+S GY+L+ YL TK LL H N Sbjct: 665 KGFMLMPEICNQLLKCLLRSQDKKDHALDLISRMRSFGYDLDFYLHQTTKFLLECHMN 722