BLASTX nr result
ID: Forsythia21_contig00026404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00026404 (396 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094128.1| PREDICTED: calcium-transporting ATPase 10, p... 74 4e-11 ref|XP_011094123.1| PREDICTED: calcium-transporting ATPase 10, p... 74 4e-11 ref|XP_012828723.1| PREDICTED: calcium-transporting ATPase 10, p... 67 4e-09 gb|EPS66913.1| hypothetical protein M569_07863, partial [Genlise... 62 1e-07 ref|XP_007014494.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Th... 57 5e-06 gb|KJB21993.1| hypothetical protein B456_004G024800 [Gossypium r... 57 6e-06 gb|KJB21991.1| hypothetical protein B456_004G024800 [Gossypium r... 57 6e-06 gb|KJB21990.1| hypothetical protein B456_004G024800 [Gossypium r... 57 6e-06 gb|KJB21987.1| hypothetical protein B456_004G024800 [Gossypium r... 57 6e-06 ref|XP_012473061.1| PREDICTED: calcium-transporting ATPase 10, p... 57 6e-06 ref|XP_012473060.1| PREDICTED: calcium-transporting ATPase 10, p... 57 6e-06 gb|KJB21984.1| hypothetical protein B456_004G024800 [Gossypium r... 57 6e-06 gb|KJB21983.1| hypothetical protein B456_004G024800 [Gossypium r... 57 6e-06 ref|XP_007138755.1| hypothetical protein PHAVU_009G234600g [Phas... 56 8e-06 >ref|XP_011094128.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type isoform X2 [Sesamum indicum] Length = 1093 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 120 SRREFDEEEDEVSGPFDIVRTKSAPVDRLRRWRQAALVLN 1 S R +DE+EDE SGPFDIVRTKSAPVDRLRRWRQAALVLN Sbjct: 22 SSRNYDEDEDEGSGPFDIVRTKSAPVDRLRRWRQAALVLN 61 >ref|XP_011094123.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type isoform X1 [Sesamum indicum] gi|747092694|ref|XP_011094124.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type isoform X1 [Sesamum indicum] gi|747092696|ref|XP_011094125.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type isoform X1 [Sesamum indicum] gi|747092698|ref|XP_011094126.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type isoform X1 [Sesamum indicum] gi|747092700|ref|XP_011094127.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type isoform X1 [Sesamum indicum] Length = 1095 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 120 SRREFDEEEDEVSGPFDIVRTKSAPVDRLRRWRQAALVLN 1 S R +DE+EDE SGPFDIVRTKSAPVDRLRRWRQAALVLN Sbjct: 22 SSRNYDEDEDEGSGPFDIVRTKSAPVDRLRRWRQAALVLN 61 >ref|XP_012828723.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type [Erythranthe guttatus] gi|848931317|ref|XP_012828724.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type [Erythranthe guttatus] Length = 1094 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -1 Query: 120 SRREFDEEEDEVSGPFDIVRTKSAPVDRLRRWRQAALVLN 1 S R +DE++D SGPF+IVRTKSAP+D+LRRWRQAALVLN Sbjct: 22 SNRNYDEDDDSGSGPFNIVRTKSAPIDQLRRWRQAALVLN 61 >gb|EPS66913.1| hypothetical protein M569_07863, partial [Genlisea aurea] Length = 1071 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = -1 Query: 114 REFDEEEDEVSGPFDIVRTKSAPVDRLRRWRQAALVLN 1 +E++ +++E GPFDI+RTKSAPVDRLR+WRQAALVLN Sbjct: 23 QEYEADDEEGLGPFDILRTKSAPVDRLRKWRQAALVLN 60 >ref|XP_007014494.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Theobroma cacao] gi|590581970|ref|XP_007014495.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Theobroma cacao] gi|590581974|ref|XP_007014496.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Theobroma cacao] gi|508784857|gb|EOY32113.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Theobroma cacao] gi|508784858|gb|EOY32114.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Theobroma cacao] gi|508784859|gb|EOY32115.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Theobroma cacao] Length = 1082 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = -1 Query: 105 DEEEDEVS-GPFDIVRTKSAPVDRLRRWRQAALVLN 1 D E+DE S GPFDI TK+AP++RLRRWRQAALVLN Sbjct: 27 DNEDDEFSAGPFDITSTKNAPIERLRRWRQAALVLN 62 >gb|KJB21993.1| hypothetical protein B456_004G024800 [Gossypium raimondii] Length = 1083 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -1 Query: 123 KSRREFDEEEDEVSGPFDIVRTKSAPVDRLRRWRQAALVLN 1 +S DE+ + + PFDI TK+AP+DRLRRWRQAALVLN Sbjct: 22 RSAHSDDEDHESFADPFDITSTKNAPIDRLRRWRQAALVLN 62 >gb|KJB21991.1| hypothetical protein B456_004G024800 [Gossypium raimondii] Length = 1017 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -1 Query: 123 KSRREFDEEEDEVSGPFDIVRTKSAPVDRLRRWRQAALVLN 1 +S DE+ + + PFDI TK+AP+DRLRRWRQAALVLN Sbjct: 22 RSAHSDDEDHESFADPFDITSTKNAPIDRLRRWRQAALVLN 62 >gb|KJB21990.1| hypothetical protein B456_004G024800 [Gossypium raimondii] Length = 1087 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -1 Query: 123 KSRREFDEEEDEVSGPFDIVRTKSAPVDRLRRWRQAALVLN 1 +S DE+ + + PFDI TK+AP+DRLRRWRQAALVLN Sbjct: 22 RSAHSDDEDHESFADPFDITSTKNAPIDRLRRWRQAALVLN 62 >gb|KJB21987.1| hypothetical protein B456_004G024800 [Gossypium raimondii] gi|763754663|gb|KJB21994.1| hypothetical protein B456_004G024800 [Gossypium raimondii] Length = 997 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -1 Query: 123 KSRREFDEEEDEVSGPFDIVRTKSAPVDRLRRWRQAALVLN 1 +S DE+ + + PFDI TK+AP+DRLRRWRQAALVLN Sbjct: 22 RSAHSDDEDHESFADPFDITSTKNAPIDRLRRWRQAALVLN 62 >ref|XP_012473061.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like isoform X2 [Gossypium raimondii] gi|763754655|gb|KJB21986.1| hypothetical protein B456_004G024800 [Gossypium raimondii] gi|763754661|gb|KJB21992.1| hypothetical protein B456_004G024800 [Gossypium raimondii] Length = 1089 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -1 Query: 123 KSRREFDEEEDEVSGPFDIVRTKSAPVDRLRRWRQAALVLN 1 +S DE+ + + PFDI TK+AP+DRLRRWRQAALVLN Sbjct: 22 RSAHSDDEDHESFADPFDITSTKNAPIDRLRRWRQAALVLN 62 >ref|XP_012473060.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like isoform X1 [Gossypium raimondii] gi|763754654|gb|KJB21985.1| hypothetical protein B456_004G024800 [Gossypium raimondii] gi|763754658|gb|KJB21989.1| hypothetical protein B456_004G024800 [Gossypium raimondii] Length = 1092 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -1 Query: 123 KSRREFDEEEDEVSGPFDIVRTKSAPVDRLRRWRQAALVLN 1 +S DE+ + + PFDI TK+AP+DRLRRWRQAALVLN Sbjct: 22 RSAHSDDEDHESFADPFDITSTKNAPIDRLRRWRQAALVLN 62 >gb|KJB21984.1| hypothetical protein B456_004G024800 [Gossypium raimondii] Length = 1092 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -1 Query: 123 KSRREFDEEEDEVSGPFDIVRTKSAPVDRLRRWRQAALVLN 1 +S DE+ + + PFDI TK+AP+DRLRRWRQAALVLN Sbjct: 22 RSAHSDDEDHESFADPFDITSTKNAPIDRLRRWRQAALVLN 62 >gb|KJB21983.1| hypothetical protein B456_004G024800 [Gossypium raimondii] gi|763754657|gb|KJB21988.1| hypothetical protein B456_004G024800 [Gossypium raimondii] Length = 1089 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -1 Query: 123 KSRREFDEEEDEVSGPFDIVRTKSAPVDRLRRWRQAALVLN 1 +S DE+ + + PFDI TK+AP+DRLRRWRQAALVLN Sbjct: 22 RSAHSDDEDHESFADPFDITSTKNAPIDRLRRWRQAALVLN 62 >ref|XP_007138755.1| hypothetical protein PHAVU_009G234600g [Phaseolus vulgaris] gi|561011842|gb|ESW10749.1| hypothetical protein PHAVU_009G234600g [Phaseolus vulgaris] Length = 1082 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -1 Query: 120 SRREFDEEEDEVSGPFDIVRTKSAPVDRLRRWRQAALVLN 1 +RR D + ++S PFDI RTK+A ++RLRRWRQAALVLN Sbjct: 25 TRRSIDLDSGDLSDPFDIARTKNASIERLRRWRQAALVLN 64