BLASTX nr result
ID: Forsythia21_contig00026128
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00026128 (336 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009792607.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_011069582.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 >ref|XP_009792607.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30825, chloroplastic-like [Nicotiana sylvestris] Length = 941 Score = 67.8 bits (164), Expect = 3e-09 Identities = 40/78 (51%), Positives = 50/78 (64%), Gaps = 4/78 (5%) Frame = -2 Query: 239 MASLKLSVSLDNSSYEPKKKFDVKSLRLPS----ICSFSGYVNIHCAFIVKPFYKLKHIR 72 MASLKLS +D S K KF+VK+L + SF GY + AF+V PF LKHIR Sbjct: 1 MASLKLSFYVDKSWESKKLKFNVKALNFTDSKCLVPSFLGYGYVGGAFVVNPFCNLKHIR 60 Query: 71 VSRIDTEFYETSEENLVD 18 VSR++TE ETSE +L+D Sbjct: 61 VSRLETEELETSELSLLD 78 >ref|XP_011069582.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30825, chloroplastic [Sesamum indicum] Length = 937 Score = 67.4 bits (163), Expect = 4e-09 Identities = 40/73 (54%), Positives = 47/73 (64%), Gaps = 1/73 (1%) Frame = -2 Query: 239 MASLKLSVSLDNSSYEPKK-KFDVKSLRLPSICSFSGYVNIHCAFIVKPFYKLKHIRVSR 63 MASLKLSVS+DNS YE KK +F + SL+ S FSGYV + A IVKPF KLK IRV+ Sbjct: 1 MASLKLSVSVDNSCYESKKQRFALNSLKFGSSTLFSGYVITNGALIVKPFCKLKQIRVNG 60 Query: 62 IDTEFYETSEENL 24 + E E L Sbjct: 61 LGNELLGAPESTL 73