BLASTX nr result
ID: Forsythia21_contig00026084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00026084 (659 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007681584.1| hypothetical protein BAUCODRAFT_315059 [Baud... 107 7e-21 ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria trit... 105 2e-20 ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [... 105 3e-20 ref|XP_008085508.1| Nucleic acid-binding protein [Glarea lozoyen... 104 4e-20 gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botry... 104 4e-20 ref|XP_001561242.1| 40S ribosomal protein S28 [Botrytis cinerea ... 104 4e-20 gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina M... 103 6e-20 ref|XP_002153086.1| 40S ribosomal protein S28 [Talaromyces marne... 103 8e-20 gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F... 103 8e-20 ref|XP_012743726.1| 40S ribosomal protein S28 [Pseudogymnoascus ... 103 8e-20 gb|KKA26499.1| hypothetical protein TD95_004483 [Thielaviopsis p... 103 1e-19 ref|XP_003650823.1| 40S ribosomal protein S28 [Thielavia terrest... 103 1e-19 ref|XP_001903978.1| hypothetical protein [Podospora anserina S m... 103 1e-19 ref|XP_003009124.1| 40S ribosomal protein S28 [Verticillium alfa... 102 2e-19 ref|XP_007779255.1| 40S ribosomal protein S28 [Coniosporium apol... 102 2e-19 gb|KJK62941.1| S1S28E like protein [Aspergillus parasiticus SU-1] 102 2e-19 gb|KDB13252.1| IBR domain-containing protein [Ustilaginoidea vir... 102 2e-19 gb|KKF94527.1| 40S ribosomal protein S28 [Ceratocystis platani] 101 3e-19 ref|XP_007600844.1| 40S ribosomal protein S28 [Colletotrichum fi... 101 4e-19 ref|XP_003664442.1| hypothetical protein MYCTH_36979, partial [M... 101 4e-19 >ref|XP_007681584.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia compniacensis UAMH 10762] gi|449295094|gb|EMC91116.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia compniacensis UAMH 10762] gi|662503260|gb|KEQ60881.1| ribosomal protein S28e [Aureobasidium melanogenum CBS 110374] gi|662518527|gb|KEQ76087.1| ribosomal protein S28e [Aureobasidium namibiae CBS 147.97] gi|662527623|gb|KEQ85002.1| ribosomal protein S28e [Aureobasidium pullulans EXF-150] Length = 68 Score = 107 bits (266), Expect = 7e-21 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -3 Query: 585 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria tritici IPO323] gi|631388890|ref|XP_007928825.1| hypothetical protein MYCFIDRAFT_49708 [Pseudocercospora fijiensis CIRAD86] gi|339470532|gb|EGP85629.1| hypothetical protein MYCGRDRAFT_81501 [Zymoseptoria tritici IPO323] gi|452980191|gb|EME79952.1| hypothetical protein MYCFIDRAFT_49708 [Pseudocercospora fijiensis CIRAD86] gi|752275464|dbj|GAM89234.1| hypothetical protein ANO11243_072710 [fungal sp. No.11243] gi|796706002|gb|KJX97506.1| 40s ribosomal protein s28 [Zymoseptoria brevis] Length = 68 Score = 105 bits (263), Expect = 2e-20 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 585 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 M+SAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|615415585|ref|XP_007584949.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485922014|gb|EOD47615.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485925270|gb|EOD49893.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] Length = 68 Score = 105 bits (261), Expect = 3e-20 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 585 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 54 >ref|XP_008085508.1| Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] gi|512199315|gb|EPE28149.1| Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] gi|751749436|gb|KIM97619.1| hypothetical protein OIDMADRAFT_20164 [Oidiodendron maius Zn] Length = 68 Score = 104 bits (260), Expect = 4e-20 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -3 Query: 585 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 M+S+KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botrytis cinerea BcDW1] Length = 114 Score = 104 bits (260), Expect = 4e-20 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -3 Query: 585 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 ME++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 47 MEASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 100 >ref|XP_001561242.1| 40S ribosomal protein S28 [Botrytis cinerea B05.10] gi|347829972|emb|CCD45669.1| hypothetical protein BofuT4P34000010001 [Botrytis cinerea T4] Length = 68 Score = 104 bits (260), Expect = 4e-20 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -3 Query: 585 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 ME++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MEASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina MS6] gi|407924574|gb|EKG17607.1| Histone core [Macrophomina phaseolina MS6] gi|821064263|gb|KKY19538.1| putative 40s ribosomal protein s28 [Diplodia seriata] gi|821064801|gb|KKY20058.1| putative 40s ribosomal protein s28 [Diplodia seriata] Length = 68 Score = 103 bits (258), Expect = 6e-20 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -3 Query: 585 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 M+SAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 54 >ref|XP_002153086.1| 40S ribosomal protein S28 [Talaromyces marneffei ATCC 18224] gi|242820646|ref|XP_002487548.1| 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] gi|242820650|ref|XP_002487549.1| 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] gi|210064606|gb|EEA18701.1| Ribosomal protein S28e [Talaromyces marneffei ATCC 18224] gi|218714013|gb|EED13437.1| Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] gi|218714014|gb|EED13438.1| Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] gi|680000722|gb|KFX52824.1| 40S ribosomal protein S28 [Talaromyces marneffei PM1] gi|748550736|dbj|GAM43411.1| ribosomal protein [Talaromyces cellulolyticus] gi|816186318|emb|CRG91631.1| hypothetical protein PISL3812_08681 [Talaromyces islandicus] Length = 68 Score = 103 bits (257), Expect = 8e-20 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -3 Query: 585 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 M+SAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F-4157] Length = 68 Score = 103 bits (257), Expect = 8e-20 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -3 Query: 585 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 M+++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MDASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_012743726.1| 40S ribosomal protein S28 [Pseudogymnoascus destructans 20631-21] gi|440632220|gb|ELR02139.1| 40S ribosomal protein S28 [Pseudogymnoascus destructans 20631-21] Length = 68 Score = 103 bits (257), Expect = 8e-20 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -3 Query: 585 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 M+++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MDTSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >gb|KKA26499.1| hypothetical protein TD95_004483 [Thielaviopsis punctulata] Length = 68 Score = 103 bits (256), Expect = 1e-19 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -3 Query: 585 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVRE+DI Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDNTRSIIRNVKGPVRENDI 54 >ref|XP_003650823.1| 40S ribosomal protein S28 [Thielavia terrestris NRRL 8126] gi|346998084|gb|AEO64487.1| hypothetical protein THITE_2110661, partial [Thielavia terrestris NRRL 8126] Length = 67 Score = 103 bits (256), Expect = 1e-19 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -3 Query: 585 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 M+S+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_001903978.1| hypothetical protein [Podospora anserina S mat+] gi|170937097|emb|CAP61755.1| unnamed protein product [Podospora anserina S mat+] gi|681098209|emb|CDP28104.1| Putative cytosolic 40S ribosomal protein Rps28 [Podospora anserina S mat+] Length = 68 Score = 103 bits (256), Expect = 1e-19 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -3 Query: 585 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 M+S+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_003009124.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|697069809|ref|XP_009650088.1| hypothetical protein VDAG_00416 [Verticillium dahliae VdLs.17] gi|261352270|gb|EEY14698.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|346970282|gb|EGY13734.1| hypothetical protein VDAG_00416 [Verticillium dahliae VdLs.17] Length = 68 Score = 102 bits (254), Expect = 2e-19 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -3 Query: 585 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 M+S+KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >ref|XP_007779255.1| 40S ribosomal protein S28 [Coniosporium apollinis CBS 100218] gi|494826922|gb|EON63938.1| 40S ribosomal protein S28 [Coniosporium apollinis CBS 100218] Length = 68 Score = 102 bits (254), Expect = 2e-19 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -3 Query: 585 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 M+SAKVPVKLVKVTRVLGRTGSRGGV+QVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVSQVRVEFMDDTTRSIIRNVKGPVRENDI 54 >gb|KJK62941.1| S1S28E like protein [Aspergillus parasiticus SU-1] Length = 1036 Score = 102 bits (253), Expect = 2e-19 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -3 Query: 597 QDFTMESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 Q F M+SAK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD +RSIIRNVKGPVR DDI Sbjct: 965 QSFAMDSAKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQSRSIIRNVKGPVRVDDI 1022 >gb|KDB13252.1| IBR domain-containing protein [Ustilaginoidea virens] Length = 480 Score = 102 bits (253), Expect = 2e-19 Identities = 51/57 (89%), Positives = 53/57 (92%) Frame = -3 Query: 594 DFTMESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 D M+S+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 410 DTIMDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 466 >gb|KKF94527.1| 40S ribosomal protein S28 [Ceratocystis platani] Length = 68 Score = 101 bits (252), Expect = 3e-19 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = -3 Query: 585 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 MESAKV VKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MESAKVQVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >ref|XP_007600844.1| 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] gi|588893325|gb|EXF75473.1| 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] Length = 68 Score = 101 bits (251), Expect = 4e-19 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -3 Query: 585 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 M+SAK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MDSAKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDETRSIIRNVKGPVREDDI 54 >ref|XP_003664442.1| hypothetical protein MYCTH_36979, partial [Myceliophthora thermophila ATCC 42464] gi|347011712|gb|AEO59197.1| hypothetical protein MYCTH_36979, partial [Myceliophthora thermophila ATCC 42464] Length = 64 Score = 101 bits (251), Expect = 4e-19 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -3 Query: 582 ESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 424 +S+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 DSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 53