BLASTX nr result
ID: Forsythia21_contig00026079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00026079 (194 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006360633.1| PREDICTED: uncharacterized protein LOC102579... 61 3e-07 >ref|XP_006360633.1| PREDICTED: uncharacterized protein LOC102579045 [Solanum tuberosum] Length = 107 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = -2 Query: 148 MNAVAKRVATLLLTSPRSALAVVNWELQQWRGIRVKVRNNNLEQAVILL 2 +++V K+V+T+ P AL +NWELQQWRGIRVKVRNNNL+QA+ L+ Sbjct: 2 ISSVMKQVSTIF-NRPNVALNPLNWELQQWRGIRVKVRNNNLDQALFLM 49