BLASTX nr result
ID: Forsythia21_contig00025401
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00025401 (582 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP02355.1| unnamed protein product [Coffea canephora] 105 1e-20 ref|XP_009775225.1| PREDICTED: uncharacterized protein LOC104225... 103 7e-20 ref|XP_009775221.1| PREDICTED: alpha/beta hydrolase domain-conta... 103 7e-20 ref|XP_009619454.1| PREDICTED: alpha/beta hydrolase domain-conta... 103 7e-20 ref|XP_011099063.1| PREDICTED: alpha/beta hydrolase domain-conta... 100 5e-19 ref|XP_012852018.1| PREDICTED: alpha/beta hydrolase domain-conta... 99 1e-18 gb|EYU44251.1| hypothetical protein MIMGU_mgv1a008700mg [Erythra... 99 1e-18 ref|XP_004232128.1| PREDICTED: alpha/beta hydrolase domain-conta... 97 7e-18 ref|XP_006338321.1| PREDICTED: alpha/beta hydrolase domain-conta... 96 2e-17 ref|XP_008807011.1| PREDICTED: alpha/beta hydrolase domain-conta... 93 8e-17 ref|XP_002533597.1| Protein bem46, putative [Ricinus communis] g... 92 2e-16 ref|XP_010999409.1| PREDICTED: alpha/beta hydrolase domain-conta... 91 4e-16 ref|XP_006430985.1| hypothetical protein CICLE_v10011937mg [Citr... 90 6e-16 ref|XP_010257896.1| PREDICTED: alpha/beta hydrolase domain-conta... 90 8e-16 ref|XP_010257891.1| PREDICTED: alpha/beta hydrolase domain-conta... 90 8e-16 ref|XP_008230316.1| PREDICTED: alpha/beta hydrolase domain-conta... 90 8e-16 ref|XP_008357926.1| PREDICTED: alpha/beta hydrolase domain-conta... 89 1e-15 ref|XP_008379469.1| PREDICTED: alpha/beta hydrolase domain-conta... 89 1e-15 ref|XP_006384257.1| hypothetical protein POPTR_0004s11120g [Popu... 89 2e-15 ref|XP_010261392.1| PREDICTED: alpha/beta hydrolase domain-conta... 88 3e-15 >emb|CDP02355.1| unnamed protein product [Coffea canephora] Length = 378 Score = 105 bits (263), Expect = 1e-20 Identities = 48/61 (78%), Positives = 57/61 (93%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFKPVG 403 REKSR S+DRRE+ RK+VD +EKANNN+EQP++ARNSIDRFG+MMRSAVLCNI+CFKP G Sbjct: 316 REKSRASVDRRERSRKSVDFSEKANNNSEQPERARNSIDRFGEMMRSAVLCNIDCFKPAG 375 Query: 402 A 400 A Sbjct: 376 A 376 >ref|XP_009775225.1| PREDICTED: uncharacterized protein LOC104225151 [Nicotiana sylvestris] Length = 219 Score = 103 bits (256), Expect = 7e-20 Identities = 47/61 (77%), Positives = 57/61 (93%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFKPVG 403 R+KSR+S+DR+EK K++D +EKANNN EQP+K+RNSIDRFGDMMRSAVLCNI+CFKPVG Sbjct: 114 RDKSRSSVDRKEKKSKSLDLSEKANNNMEQPEKSRNSIDRFGDMMRSAVLCNIDCFKPVG 173 Query: 402 A 400 A Sbjct: 174 A 174 >ref|XP_009775221.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Nicotiana sylvestris] gi|698572732|ref|XP_009775222.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Nicotiana sylvestris] Length = 377 Score = 103 bits (256), Expect = 7e-20 Identities = 47/61 (77%), Positives = 57/61 (93%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFKPVG 403 R+KSR+S+DR+EK K++D +EKANNN EQP+K+RNSIDRFGDMMRSAVLCNI+CFKPVG Sbjct: 315 RDKSRSSVDRKEKKSKSLDLSEKANNNMEQPEKSRNSIDRFGDMMRSAVLCNIDCFKPVG 374 Query: 402 A 400 A Sbjct: 375 A 375 >ref|XP_009619454.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Nicotiana tomentosiformis] gi|697130805|ref|XP_009619455.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Nicotiana tomentosiformis] gi|697130807|ref|XP_009619456.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Nicotiana tomentosiformis] gi|697130809|ref|XP_009619457.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Nicotiana tomentosiformis] Length = 377 Score = 103 bits (256), Expect = 7e-20 Identities = 47/61 (77%), Positives = 57/61 (93%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFKPVG 403 R+KSR+S+DR+EK K++D +EKANNN EQP+K+RNSIDRFGDMMRSAVLCNI+CFKPVG Sbjct: 315 RDKSRSSVDRKEKKSKSLDLSEKANNNMEQPEKSRNSIDRFGDMMRSAVLCNIDCFKPVG 374 Query: 402 A 400 A Sbjct: 375 A 375 >ref|XP_011099063.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C [Sesamum indicum] gi|747101841|ref|XP_011099064.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C [Sesamum indicum] Length = 378 Score = 100 bits (249), Expect = 5e-19 Identities = 46/60 (76%), Positives = 54/60 (90%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFKPVG 403 REKSR S D+RE+ R++VD+AEK NN EQP++ARNSIDRFGDMMRSAVLCNI+CFKPVG Sbjct: 316 REKSRVSTDKRERSRRSVDYAEKTNNIVEQPERARNSIDRFGDMMRSAVLCNIDCFKPVG 375 >ref|XP_012852018.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C [Erythranthe guttatus] Length = 372 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/60 (76%), Positives = 54/60 (90%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFKPVG 403 REKSR SID+RE+ RKN++ +EK +N EQP+KARNSIDRFGDMMRSAVLCNI+CFKPVG Sbjct: 310 REKSRASIDKRERSRKNMELSEKTSNVTEQPEKARNSIDRFGDMMRSAVLCNIDCFKPVG 369 >gb|EYU44251.1| hypothetical protein MIMGU_mgv1a008700mg [Erythranthe guttata] Length = 365 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/60 (76%), Positives = 54/60 (90%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFKPVG 403 REKSR SID+RE+ RKN++ +EK +N EQP+KARNSIDRFGDMMRSAVLCNI+CFKPVG Sbjct: 303 REKSRASIDKRERSRKNMELSEKTSNVTEQPEKARNSIDRFGDMMRSAVLCNIDCFKPVG 362 >ref|XP_004232128.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B [Solanum lycopersicum] Length = 377 Score = 96.7 bits (239), Expect = 7e-18 Identities = 46/61 (75%), Positives = 54/61 (88%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFKPVG 403 REKSR SIDR+EK K+VD ++KAN+N EQ +KAR SIDRFG+MMRSAVLCNI+CFKPVG Sbjct: 315 REKSRASIDRKEKSSKSVDLSDKANDNTEQQEKARKSIDRFGNMMRSAVLCNIDCFKPVG 374 Query: 402 A 400 A Sbjct: 375 A 375 >ref|XP_006338321.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like isoform X1 [Solanum tuberosum] gi|565342352|ref|XP_006338322.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like isoform X2 [Solanum tuberosum] Length = 377 Score = 95.5 bits (236), Expect = 2e-17 Identities = 45/61 (73%), Positives = 54/61 (88%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFKPVG 403 R+KSR SIDR+EK K+VD ++KAN+N EQ +KAR SIDRFG+MMRSAVLCNI+CFKPVG Sbjct: 315 RDKSRASIDRKEKSSKSVDLSDKANDNTEQSEKARKSIDRFGNMMRSAVLCNIDCFKPVG 374 Query: 402 A 400 A Sbjct: 375 A 375 >ref|XP_008807011.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like [Phoenix dactylifera] Length = 419 Score = 93.2 bits (230), Expect = 8e-17 Identities = 43/57 (75%), Positives = 49/57 (85%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFK 412 REKSRTS DRREK RK+VDHA+K N+N +QP+K R SIDRFGDMMRS LCNI+CFK Sbjct: 357 REKSRTSTDRREKSRKSVDHADKVNDNPDQPEKPRKSIDRFGDMMRSVGLCNIDCFK 413 >ref|XP_002533597.1| Protein bem46, putative [Ricinus communis] gi|223526526|gb|EEF28788.1| Protein bem46, putative [Ricinus communis] Length = 373 Score = 91.7 bits (226), Expect = 2e-16 Identities = 43/59 (72%), Positives = 52/59 (88%), Gaps = 1/59 (1%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNA-EQPDKARNSIDRFGDMMRSAVLCNINCFKP 409 REKSR SIDRR+K RK+VDH+EK NNN+ + P+KARNSIDRFGDM+RS LCNI+CF+P Sbjct: 310 REKSRISIDRRDKSRKSVDHSEKENNNSSDHPEKARNSIDRFGDMIRSVGLCNIDCFRP 368 >ref|XP_010999409.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like [Populus euphratica] Length = 393 Score = 90.9 bits (224), Expect = 4e-16 Identities = 41/60 (68%), Positives = 51/60 (85%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFKPVG 403 REKSR+S DRRE+ RK+VDH E+ +N ++Q +KARNSIDRFGDM+RS LCNI+CFKP G Sbjct: 331 REKSRSSTDRRERSRKSVDHPERESNGSDQHEKARNSIDRFGDMIRSVGLCNIDCFKPTG 390 >ref|XP_006430985.1| hypothetical protein CICLE_v10011937mg [Citrus clementina] gi|557533042|gb|ESR44225.1| hypothetical protein CICLE_v10011937mg [Citrus clementina] Length = 388 Score = 90.1 bits (222), Expect = 6e-16 Identities = 42/58 (72%), Positives = 48/58 (82%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFKP 409 +EKSRTSIDRREK RK+VDH EK+ N + P+KARNSIDR G MMRS LCNI+CFKP Sbjct: 326 KEKSRTSIDRREKSRKSVDHPEKSINGTDPPEKARNSIDRLGGMMRSVKLCNIDCFKP 383 >ref|XP_010257896.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C isoform X2 [Nelumbo nucifera] Length = 263 Score = 89.7 bits (221), Expect = 8e-16 Identities = 41/61 (67%), Positives = 49/61 (80%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFKPVG 403 REKSR S DRREK RK+ D EKA ++ +QP++ARNSIDRFGDMMRS LCNI+CFKP Sbjct: 201 REKSRASTDRREKSRKSTDRPEKARSSTDQPERARNSIDRFGDMMRSVGLCNIDCFKPTA 260 Query: 402 A 400 + Sbjct: 261 S 261 >ref|XP_010257891.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B isoform X1 [Nelumbo nucifera] gi|720006168|ref|XP_010257892.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B isoform X1 [Nelumbo nucifera] gi|720006171|ref|XP_010257894.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B isoform X1 [Nelumbo nucifera] gi|720006174|ref|XP_010257895.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B isoform X1 [Nelumbo nucifera] Length = 370 Score = 89.7 bits (221), Expect = 8e-16 Identities = 41/61 (67%), Positives = 49/61 (80%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFKPVG 403 REKSR S DRREK RK+ D EKA ++ +QP++ARNSIDRFGDMMRS LCNI+CFKP Sbjct: 308 REKSRASTDRREKSRKSTDRPEKARSSTDQPERARNSIDRFGDMMRSVGLCNIDCFKPTA 367 Query: 402 A 400 + Sbjct: 368 S 368 >ref|XP_008230316.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B [Prunus mume] Length = 380 Score = 89.7 bits (221), Expect = 8e-16 Identities = 40/58 (68%), Positives = 49/58 (84%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFKP 409 REKSR S D+RE+ RK+ DH EKA+N+ +QP+KARNSIDRFG+M RS LCNI+CFKP Sbjct: 318 REKSRASTDKRERSRKSTDHPEKASNSMDQPEKARNSIDRFGEMFRSVGLCNIDCFKP 375 >ref|XP_008357926.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like [Malus domestica] Length = 281 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/58 (68%), Positives = 49/58 (84%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFKP 409 REKSR S DRRE+ RK++D EKA+N+ EQP++ARNSIDRFG+M RS LCNI+CFKP Sbjct: 219 REKSRASTDRRERTRKSMDQPEKASNSVEQPERARNSIDRFGEMFRSVGLCNIDCFKP 276 >ref|XP_008379469.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C isoform X1 [Malus domestica] Length = 380 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/58 (68%), Positives = 49/58 (84%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFKP 409 REKSR S DRRE+ RK++D EKA+N+ EQP++ARNSIDRFG+M RS LCNI+CFKP Sbjct: 318 REKSRASTDRRERTRKSMDQPEKASNSVEQPERARNSIDRFGEMFRSVGLCNIDCFKP 375 >ref|XP_006384257.1| hypothetical protein POPTR_0004s11120g [Populus trichocarpa] gi|550340803|gb|ERP62054.1| hypothetical protein POPTR_0004s11120g [Populus trichocarpa] Length = 390 Score = 88.6 bits (218), Expect = 2e-15 Identities = 40/58 (68%), Positives = 50/58 (86%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFKP 409 REKSR+S DRRE+ RK+VDH E+ +N ++Q +KARNSIDRFGDM+RS LCNI+CFKP Sbjct: 328 REKSRSSTDRRERSRKSVDHPERESNGSDQHEKARNSIDRFGDMIRSVGLCNIDCFKP 385 >ref|XP_010261392.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Nelumbo nucifera] Length = 380 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = -1 Query: 582 REKSRTSIDRREKLRKNVDHAEKANNNAEQPDKARNSIDRFGDMMRSAVLCNINCFK 412 REKSR S DRREK RK+VD +KA N+ +QP+KARNSIDRFGD+MRS LCNI+CFK Sbjct: 318 REKSRISTDRREKSRKSVDRPDKARNSIDQPEKARNSIDRFGDVMRSVRLCNIHCFK 374