BLASTX nr result
ID: Forsythia21_contig00025399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00025399 (238 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007674224.1| hypothetical protein BAUCODRAFT_398876 [Baud... 75 1e-11 gb|KIW02226.1| hypothetical protein PV09_06380 [Verruconis gallo... 68 3e-09 ref|XP_007833735.1| hypothetical protein PFICI_06963 [Pestalotio... 67 6e-09 gb|EWC43460.1| hypothetical protein DRE_07570 [Drechslerella ste... 63 7e-08 gb|ENH77271.1| putative glycine-rich protein [Colletotrichum orb... 63 9e-08 ref|XP_008089473.1| hypothetical protein GLRG_00597 [Colletotric... 63 9e-08 gb|EME46651.1| hypothetical protein DOTSEDRAFT_70608 [Dothistrom... 62 2e-07 ref|XP_001220937.1| hypothetical protein CHGG_01716 [Chaetomium ... 61 3e-07 gb|KJR79850.1| hypothetical protein SPSK_00046 [Sporothrix schen... 61 3e-07 gb|ERS96864.1| hypothetical protein HMPREF1624_07073 [Sporothrix... 61 3e-07 ref|XP_007782527.1| hypothetical protein W97_06463 [Coniosporium... 61 3e-07 gb|KFY25988.1| hypothetical protein V493_04327 [Pseudogymnoascus... 60 4e-07 ref|XP_003658578.1| hypothetical protein MYCTH_2294498 [Myceliop... 60 4e-07 ref|XP_001272303.1| conserved glycine-rich protein [Aspergillus ... 60 4e-07 emb|CEJ55215.1| hypothetical protein PMG11_01484 [Penicillium br... 60 6e-07 ref|XP_001262878.1| conserved glycine-rich protein [Neosartorya ... 60 6e-07 gb|KEY82206.1| hypothetical protein glycine rich protein [Asperg... 60 7e-07 gb|EPS30876.1| hypothetical protein PDE_05828 [Penicillium oxali... 60 7e-07 emb|CCF39680.1| hypothetical protein CH063_10453 [Colletotrichum... 60 7e-07 ref|XP_746687.2| conserved glycine-rich protein [Aspergillus fum... 60 7e-07 >ref|XP_007674224.1| hypothetical protein BAUCODRAFT_398876 [Baudoinia compniacensis UAMH 10762] gi|449303303|gb|EMC99311.1| hypothetical protein BAUCODRAFT_398876 [Baudoinia compniacensis UAMH 10762] Length = 244 Score = 75.5 bits (184), Expect = 1e-11 Identities = 32/58 (55%), Positives = 40/58 (68%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDDTDDQSYLNEVAND 9 WL GAY+Y Y P TY+N TS QN+T V+CLC NAECGCD +D Y+N +AN+ Sbjct: 125 WLYGAYAYAY--PHPYTYHNNTSNQNQTLPVECLCGGNAECGCDSNNDTDYINTIANN 180 >gb|KIW02226.1| hypothetical protein PV09_06380 [Verruconis gallopava] Length = 259 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDDTDDQSYLN 24 WL GAY Y Y P +YN TS +NE++ V CLC + + CGCDD DDQSYLN Sbjct: 138 WLYGAYLYPYTH--PYYWYNSTSHRNESKPVNCLCQQYSVCGCDDNDDQSYLN 188 >ref|XP_007833735.1| hypothetical protein PFICI_06963 [Pestalotiopsis fici W106-1] gi|573062253|gb|ETS81961.1| hypothetical protein PFICI_06963 [Pestalotiopsis fici W106-1] Length = 322 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/56 (51%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDD-TDDQSYLNEV 18 WLAGAY Y Y P +YYN +S QNET+ V+CLC + ECGC+D + D+ Y+N + Sbjct: 196 WLAGAYHYPYAH--PYSYYNHSSNQNETKPVECLCKTDEECGCEDNSSDEEYMNGI 249 >gb|EWC43460.1| hypothetical protein DRE_07570 [Drechslerella stenobrocha 248] Length = 327 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDDTDDQSYLNEV 18 WL YSY YN P YYNET Q +T VQCLC + +EC CDD + S+L+E+ Sbjct: 212 WLYSVYSYHYNT--PYRYYNETRQQEQTVPVQCLCMQYSECACDDNGNTSFLDEL 264 >gb|ENH77271.1| putative glycine-rich protein [Colletotrichum orbiculare MAFF 240422] Length = 280 Score = 62.8 bits (151), Expect = 9e-08 Identities = 24/55 (43%), Positives = 36/55 (65%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDDTDDQSYLNEV 18 WLA AY Y Y+ P +YNET+ +N+T+ +QC C EN CGCD+ + Y++ + Sbjct: 155 WLASAYMYPYHH--PYRFYNETARENQTKPIQCACVENQPCGCDENNSTEYMSSL 207 >ref|XP_008089473.1| hypothetical protein GLRG_00597 [Colletotrichum graminicola M1.001] gi|310789920|gb|EFQ25453.1| hypothetical protein GLRG_00597 [Colletotrichum graminicola M1.001] Length = 312 Score = 62.8 bits (151), Expect = 9e-08 Identities = 26/55 (47%), Positives = 37/55 (67%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDDTDDQSYLNEV 18 WLAGAY Y Y+ P YYNET+ +N+T+ V C CAE+ CGC++ + Y+N + Sbjct: 188 WLAGAYMYPYSH--PYRYYNETARENQTKAVLCGCAEDLPCGCEENNATDYMNSL 240 >gb|EME46651.1| hypothetical protein DOTSEDRAFT_70608 [Dothistroma septosporum NZE10] Length = 246 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/58 (43%), Positives = 40/58 (68%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDDTDDQSYLNEVAND 9 WL Y+Y Y+ + P Y+N+TS +NE++ ++CLC + CGCD ++ SYL+ VAN+ Sbjct: 130 WLGSVYAYSYHGNYP--YHNQTSDRNESKPIECLCDQYNPCGCDPKNETSYLDAVANN 185 >ref|XP_001220937.1| hypothetical protein CHGG_01716 [Chaetomium globosum CBS 148.51] gi|88186013|gb|EAQ93481.1| hypothetical protein CHGG_01716 [Chaetomium globosum CBS 148.51] Length = 310 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/58 (41%), Positives = 38/58 (65%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDDTDDQSYLNEVAND 9 WL GA+ RY+ + P T+YN T+ +NE++ V C C+ +CGCD+ D+ YL+ + D Sbjct: 188 WLYGAH--RYHFEHPYTFYNSTTQRNESKPVDCACSPRGDCGCDENPDKQYLDSLIGD 243 >gb|KJR79850.1| hypothetical protein SPSK_00046 [Sporothrix schenckii 1099-18] Length = 334 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/55 (45%), Positives = 35/55 (63%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDDTDDQSYLNEV 18 W Y Y Y+ P TY+NETSG+NETR + C C + EC CDD + +Y+N++ Sbjct: 209 WYHPIYYYPYSH--PYTYHNETSGKNETRNIGCGCDQTVECACDDNTNATYMNDL 261 >gb|ERS96864.1| hypothetical protein HMPREF1624_07073 [Sporothrix schenckii ATCC 58251] Length = 340 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/55 (45%), Positives = 35/55 (63%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDDTDDQSYLNEV 18 W Y Y Y+ P TY+NETSG+NETR + C C + EC CDD + +Y+N++ Sbjct: 215 WYHPIYYYPYSH--PYTYHNETSGKNETRNIGCGCDQTVECACDDNTNATYMNDL 267 >ref|XP_007782527.1| hypothetical protein W97_06463 [Coniosporium apollinis CBS 100218] gi|494830685|gb|EON67210.1| hypothetical protein W97_06463 [Coniosporium apollinis CBS 100218] Length = 270 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/62 (46%), Positives = 39/62 (62%), Gaps = 7/62 (11%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETS-------GQNETRRVQCLCAENAECGCDDTDDQSYLN 24 WL GAY Y YN P + NE++ G N TR VQCLC + + CGCD+TDD++Y+ Sbjct: 141 WLYGAYVYGYNN--PYRFINESAANATFPNGINMTRPVQCLCQQYSVCGCDETDDETYMR 198 Query: 23 EV 18 E+ Sbjct: 199 EL 200 >gb|KFY25988.1| hypothetical protein V493_04327 [Pseudogymnoascus pannorum VKM F-4281 (FW-2241)] Length = 320 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/58 (44%), Positives = 34/58 (58%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDDTDDQSYLNEVAND 9 W YSY Y T++N T +N+T+ VQCLC E AECGCDD +D Y ++ D Sbjct: 179 WNHRVYSYPYKNTW--TFFNSTENRNQTKPVQCLCEEFAECGCDDNEDPQYQKDILGD 234 >ref|XP_003658578.1| hypothetical protein MYCTH_2294498 [Myceliophthora thermophila ATCC 42464] gi|347005845|gb|AEO53333.1| hypothetical protein MYCTH_2294498 [Myceliophthora thermophila ATCC 42464] Length = 258 Score = 60.5 bits (145), Expect = 4e-07 Identities = 23/55 (41%), Positives = 41/55 (74%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDDTDDQSYLNEV 18 WL GA+ YR++++ ++N TS + E++ V+C CA+NA+CGCD+ D+ YL+++ Sbjct: 136 WLYGAHIYRFDDE--YEFFNVTSQRTESKPVECACAQNADCGCDENRDKDYLDDL 188 >ref|XP_001272303.1| conserved glycine-rich protein [Aspergillus clavatus NRRL 1] gi|119400452|gb|EAW10877.1| conserved glycine-rich protein [Aspergillus clavatus NRRL 1] Length = 281 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/57 (47%), Positives = 36/57 (63%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDDTDDQSYLNEVAN 12 WL GAY+Y Y+ Y NETS QNE+ V CLC E + CGCDD ++++Y + N Sbjct: 150 WLYGAYAYPYSHH--YNYRNETSQQNESMPVVCLCQEYSPCGCDDNNNRTYYESIFN 204 >emb|CEJ55215.1| hypothetical protein PMG11_01484 [Penicillium brasilianum] Length = 295 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/57 (45%), Positives = 35/57 (61%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDDTDDQSYLNEVAN 12 WLAGAY+Y Y Y+N T+ +NE+ V CLC E ECGCDD ++ +Y + N Sbjct: 163 WLAGAYAYNYPHG--YNYHNNTNNKNESLPVVCLCEEYQECGCDDNNNSTYYESLFN 217 >ref|XP_001262878.1| conserved glycine-rich protein [Neosartorya fischeri NRRL 181] gi|119411036|gb|EAW20981.1| conserved glycine-rich protein [Neosartorya fischeri NRRL 181] Length = 257 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/57 (47%), Positives = 37/57 (64%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDDTDDQSYLNEVAN 12 WL GAY+Y Y+ Y NETS QNE+ V CLC E ++CGCDD+++ +Y + N Sbjct: 137 WLYGAYAYPYSHR--YNYTNETSRQNESLPVVCLCQEYSDCGCDDSNNSTYYQSLFN 191 >gb|KEY82206.1| hypothetical protein glycine rich protein [Aspergillus fumigatus var. RP-2014] Length = 256 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/57 (45%), Positives = 37/57 (64%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDDTDDQSYLNEVAN 12 WL GAY+Y Y+ Y NETS QNE+ V CLC ++++CGCDD ++ +Y + N Sbjct: 136 WLYGAYAYPYSHR--YNYTNETSRQNESLPVVCLCQDHSDCGCDDNNNSTYYQSLFN 190 >gb|EPS30876.1| hypothetical protein PDE_05828 [Penicillium oxalicum 114-2] Length = 272 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/57 (43%), Positives = 37/57 (64%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDDTDDQSYLNEVAN 12 WLAGAY+Y YN YY +G+N++ V CLC + ECGC+D ++Q+Y ++ N Sbjct: 155 WLAGAYAYSYNHP----YYYNHNGRNDSLPVTCLCEKYQECGCEDNNNQTYYQDLFN 207 >emb|CCF39680.1| hypothetical protein CH063_10453 [Colletotrichum higginsianum] Length = 306 Score = 59.7 bits (143), Expect = 7e-07 Identities = 24/55 (43%), Positives = 37/55 (67%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDDTDDQSYLNEV 18 WLAGA+ Y Y+ P YYN+T+ +N+T+ V C CAE+ CGC++ + Y+N + Sbjct: 210 WLAGAHMYPYSH--PYRYYNQTARENQTKAVLCGCAEDLPCGCEENNATDYMNSL 262 >ref|XP_746687.2| conserved glycine-rich protein [Aspergillus fumigatus Af293] gi|129555384|gb|EAL84649.2| conserved glycine-rich protein [Aspergillus fumigatus Af293] gi|159123067|gb|EDP48187.1| conserved glycine-rich protein [Aspergillus fumigatus A1163] gi|846910019|gb|KMK55951.1| conserved glycine-rich protein [Aspergillus fumigatus Z5] Length = 256 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/57 (47%), Positives = 36/57 (63%) Frame = -3 Query: 182 WLAGAYSYRYNEDRPVTYYNETSGQNETRRVQCLCAENAECGCDDTDDQSYLNEVAN 12 WL GAY+Y Y+ Y NETS QNE+ V CLC E ++CGCDD ++ +Y + N Sbjct: 136 WLYGAYAYPYSHR--YNYTNETSRQNESLPVVCLCQEYSDCGCDDNNNSTYYQSLFN 190