BLASTX nr result
ID: Forsythia21_contig00025325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00025325 (226 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074728.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 85 2e-14 ref|XP_010935220.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 81 2e-13 ref|XP_010935219.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 81 2e-13 gb|KDO85020.1| hypothetical protein CISIN_1g041164mg [Citrus sin... 80 7e-13 ref|XP_006435296.1| hypothetical protein CICLE_v10001644mg [Citr... 80 7e-13 ref|XP_008781246.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 79 9e-13 ref|XP_012839213.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 78 2e-12 gb|EYU36819.1| hypothetical protein MIMGU_mgv1a009088mg [Erythra... 78 2e-12 ref|XP_009408196.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 77 3e-12 gb|KFK34459.1| hypothetical protein AALP_AA5G148100 [Arabis alpina] 77 3e-12 ref|XP_012073692.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 77 6e-12 ref|XP_010063105.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 77 6e-12 ref|XP_009793260.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 76 8e-12 ref|XP_009592937.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 76 8e-12 ref|XP_006301165.1| hypothetical protein CARUB_v10021562mg, part... 76 8e-12 emb|CDP07319.1| unnamed protein product [Coffea canephora] 76 1e-11 ref|XP_010428668.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 75 1e-11 ref|XP_006355236.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 75 1e-11 ref|XP_006390227.1| hypothetical protein EUTSA_v10018770mg [Eutr... 75 1e-11 ref|XP_006390226.1| hypothetical protein EUTSA_v10018770mg [Eutr... 75 1e-11 >ref|XP_011074728.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Sesamum indicum] Length = 359 Score = 85.1 bits (209), Expect = 2e-14 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 133 AAKLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 AAK +GGR C++CNDRRPALKRPKTLEQIC+ECFY VFEDEIH Sbjct: 10 AAKPRGGRFCTVCNDRRPALKRPKTLEQICKECFYAVFEDEIH 52 >ref|XP_010935220.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like isoform X2 [Elaeis guineensis] Length = 322 Score = 81.3 bits (199), Expect = 2e-13 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = -1 Query: 142 AEAAAKLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIHN 2 A+ K GRLCSICN ++PALKRPKTLEQICRECFY+VFE+EIHN Sbjct: 6 ADGKPKRAAGRLCSICNQKKPALKRPKTLEQICRECFYSVFEEEIHN 52 >ref|XP_010935219.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like isoform X1 [Elaeis guineensis] Length = 362 Score = 81.3 bits (199), Expect = 2e-13 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = -1 Query: 142 AEAAAKLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIHN 2 A+ K GRLCSICN ++PALKRPKTLEQICRECFY+VFE+EIHN Sbjct: 6 ADGKPKRAAGRLCSICNQKKPALKRPKTLEQICRECFYSVFEEEIHN 52 >gb|KDO85020.1| hypothetical protein CISIN_1g041164mg [Citrus sinensis] Length = 357 Score = 79.7 bits (195), Expect = 7e-13 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -1 Query: 151 LAMAEAAAKLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 + +AE+ +K GGRLCS CN R+ ALKRPKTLEQICRECFY VFE+EIH Sbjct: 1 MEVAESKSKKAGGRLCSTCNQRKAALKRPKTLEQICRECFYEVFEEEIH 49 >ref|XP_006435296.1| hypothetical protein CICLE_v10001644mg [Citrus clementina] gi|568839558|ref|XP_006473748.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Citrus sinensis] gi|557537418|gb|ESR48536.1| hypothetical protein CICLE_v10001644mg [Citrus clementina] Length = 356 Score = 79.7 bits (195), Expect = 7e-13 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -1 Query: 151 LAMAEAAAKLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 + +AE+ +K GGRLCS CN R+ ALKRPKTLEQICRECFY VFE+EIH Sbjct: 1 MEVAESKSKKAGGRLCSTCNQRKAALKRPKTLEQICRECFYEVFEEEIH 49 >ref|XP_008781246.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Phoenix dactylifera] Length = 362 Score = 79.3 bits (194), Expect = 9e-13 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -1 Query: 142 AEAAAKLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIHN 2 A K GRLCSICN ++PALKRPKTLEQICRECFY+VFE+EIHN Sbjct: 6 ANGKPKRAVGRLCSICNQKKPALKRPKTLEQICRECFYSVFEEEIHN 52 >ref|XP_012839213.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Erythranthe guttatus] Length = 358 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -1 Query: 145 MAEAAAKLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 +AE K +GGR C++CN RR ALKRPKTLEQIC+ECFY VFEDEIH Sbjct: 5 VAEETPKPRGGRFCTLCNARRAALKRPKTLEQICKECFYEVFEDEIH 51 >gb|EYU36819.1| hypothetical protein MIMGU_mgv1a009088mg [Erythranthe guttata] Length = 353 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -1 Query: 145 MAEAAAKLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 +AE K +GGR C++CN RR ALKRPKTLEQIC+ECFY VFEDEIH Sbjct: 5 VAEETPKPRGGRFCTLCNARRAALKRPKTLEQICKECFYEVFEDEIH 51 >ref|XP_009408196.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 isoform X1 [Musa acuminata subsp. malaccensis] Length = 362 Score = 77.4 bits (189), Expect = 3e-12 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = -1 Query: 142 AEAAAKLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIHN 2 A A + GRLCS CN R+ ALKRPKTLEQICRECFY+VFEDEIHN Sbjct: 6 ATARPRRATGRLCSTCNQRKAALKRPKTLEQICRECFYSVFEDEIHN 52 >gb|KFK34459.1| hypothetical protein AALP_AA5G148100 [Arabis alpina] Length = 360 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = -1 Query: 151 LAMAEAAAKLKGG-RLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 + + EA +K GG RLC ICN RRP LKRPKTLEQICRECFY VFE+EIH Sbjct: 1 MEVTEAKSKKAGGARLCCICNQRRPVLKRPKTLEQICRECFYEVFEEEIH 50 >ref|XP_012073692.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Jatropha curcas] gi|643728909|gb|KDP36846.1| hypothetical protein JCGZ_08137 [Jatropha curcas] Length = 356 Score = 76.6 bits (187), Expect = 6e-12 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = -1 Query: 142 AEAAAKLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 A+ AK G RLC +CN RR ALKRPKTLEQICRECFY VFE+EIH Sbjct: 4 ADTKAKRTGARLCCLCNQRRAALKRPKTLEQICRECFYDVFEEEIH 49 >ref|XP_010063105.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Eucalyptus grandis] gi|629104828|gb|KCW70297.1| hypothetical protein EUGRSUZ_F03540 [Eucalyptus grandis] Length = 357 Score = 76.6 bits (187), Expect = 6e-12 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 3/50 (6%) Frame = -1 Query: 145 MAEAAAKLK---GGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 MAE+ AK++ GGR C +CN+RR ALKRPKTLEQICRECF+ VFE+EIH Sbjct: 1 MAESPAKVQKAGGGRSCCVCNERRAALKRPKTLEQICRECFFAVFEEEIH 50 >ref|XP_009793260.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Nicotiana sylvestris] Length = 352 Score = 76.3 bits (186), Expect = 8e-12 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -1 Query: 139 EAAAKLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 E AAK +G RLC++CN++R ALKRPKTLEQICRECFY VFEDEIH Sbjct: 2 EKAAKPRG-RLCTLCNEKRAALKRPKTLEQICRECFYAVFEDEIH 45 >ref|XP_009592937.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 {ECO:0000255|HAMAP-Rule:MF_03053}-like [Nicotiana tomentosiformis] Length = 352 Score = 76.3 bits (186), Expect = 8e-12 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -1 Query: 139 EAAAKLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 E AAK +G RLC++CN++R ALKRPKTLEQICRECFY VFEDEIH Sbjct: 2 EKAAKPRG-RLCTLCNEKRAALKRPKTLEQICRECFYAVFEDEIH 45 >ref|XP_006301165.1| hypothetical protein CARUB_v10021562mg, partial [Capsella rubella] gi|482569875|gb|EOA34063.1| hypothetical protein CARUB_v10021562mg, partial [Capsella rubella] Length = 392 Score = 76.3 bits (186), Expect = 8e-12 Identities = 37/61 (60%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = -1 Query: 184 ILVAPLPGLPFLAMAEAAAKLKGG-RLCSICNDRRPALKRPKTLEQICRECFYTVFEDEI 8 I ++ P + EA +K GG RLC ICN RRP LKRPKTL+QICRECFY VFE+EI Sbjct: 32 IRLSEYPSPLMMEAGEAKSKKAGGSRLCCICNKRRPVLKRPKTLQQICRECFYEVFEEEI 91 Query: 7 H 5 H Sbjct: 92 H 92 >emb|CDP07319.1| unnamed protein product [Coffea canephora] Length = 356 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/45 (75%), Positives = 36/45 (80%) Frame = -1 Query: 139 EAAAKLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 E AK GR C+ICN RR ALKRPKTLEQICRECFY VFE+EIH Sbjct: 5 EVVAKPPKGRFCTICNQRRAALKRPKTLEQICRECFYAVFEEEIH 49 >ref|XP_010428668.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Camelina sativa] Length = 357 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/47 (74%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = -1 Query: 142 AEAAAKLKGG-RLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 +EA +K GG RLC ICN RRP LKRPKTL+QICRECFY VFE+EIH Sbjct: 4 SEAKSKRAGGSRLCCICNKRRPVLKRPKTLQQICRECFYEVFEEEIH 50 >ref|XP_006355236.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Solanum tuberosum] Length = 352 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -1 Query: 139 EAAAKLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 E AK K RLC++CN++R ALKRPKTLEQICRECFYTVFEDEIH Sbjct: 2 EKTAKPKS-RLCTLCNEKRAALKRPKTLEQICRECFYTVFEDEIH 45 >ref|XP_006390227.1| hypothetical protein EUTSA_v10018770mg [Eutrema salsugineum] gi|557086661|gb|ESQ27513.1| hypothetical protein EUTSA_v10018770mg [Eutrema salsugineum] Length = 356 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/46 (76%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = -1 Query: 139 EAAAKLKGG-RLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 EA +K GG RLC ICN RRP LKRPKTL+QICRECFY VFE+EIH Sbjct: 5 EAKSKKAGGPRLCCICNQRRPVLKRPKTLQQICRECFYEVFEEEIH 50 >ref|XP_006390226.1| hypothetical protein EUTSA_v10018770mg [Eutrema salsugineum] gi|557086660|gb|ESQ27512.1| hypothetical protein EUTSA_v10018770mg [Eutrema salsugineum] Length = 304 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/46 (76%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = -1 Query: 139 EAAAKLKGG-RLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 EA +K GG RLC ICN RRP LKRPKTL+QICRECFY VFE+EIH Sbjct: 5 EAKSKKAGGPRLCCICNQRRPVLKRPKTLQQICRECFYEVFEEEIH 50