BLASTX nr result
ID: Forsythia21_contig00025312
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00025312 (222 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003548652.1| PREDICTED: cytochrome P450 82C4-like [Glycin... 60 4e-07 ref|XP_007134137.1| hypothetical protein PHAVU_010G022400g [Phas... 60 7e-07 ref|XP_002300088.2| hypothetical protein POPTR_0001s34230g [Popu... 58 2e-06 >ref|XP_003548652.1| PREDICTED: cytochrome P450 82C4-like [Glycine max] Length = 521 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/51 (56%), Positives = 38/51 (74%), Gaps = 4/51 (7%) Frame = -3 Query: 142 WSRKS----KVNGISPPEPAGALPVIGHLHLLGGSGPTTVSRVFAALADKY 2 W +KS K+ G+ PPEP+ ALP+IGHLHLLG P ++R+FA+LADKY Sbjct: 23 WRKKSSTIHKIKGLQPPEPSFALPLIGHLHLLGAKTP--LARIFASLADKY 71 >ref|XP_007134137.1| hypothetical protein PHAVU_010G022400g [Phaseolus vulgaris] gi|561007182|gb|ESW06131.1| hypothetical protein PHAVU_010G022400g [Phaseolus vulgaris] Length = 526 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = -3 Query: 139 SRKSKVNGISPPEPAGALPVIGHLHLLGGSGPTTVSRVFAALADKY 2 S+KSK G PPEP+GALP+IGHLHLLG P ++R FAALADKY Sbjct: 30 SQKSK--GAEPPEPSGALPLIGHLHLLGAQTP--LARTFAALADKY 71 >ref|XP_002300088.2| hypothetical protein POPTR_0001s34230g [Populus trichocarpa] gi|550348826|gb|EEE84893.2| hypothetical protein POPTR_0001s34230g [Populus trichocarpa] Length = 527 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -3 Query: 139 SRKSKVNGISPPEPAGALPVIGHLHLLGGSGPTTVSRVFAALADKY 2 SR+ G+ PPEP+GALP+IGHLHLLG T++R AA+ADKY Sbjct: 28 SRRKTEKGLQPPEPSGALPLIGHLHLLGAQ--KTLARTLAAMADKY 71