BLASTX nr result
ID: Forsythia21_contig00025271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00025271 (413 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP12314.1| unnamed protein product [Coffea canephora] 91 3e-16 emb|CDO97956.1| unnamed protein product [Coffea canephora] 89 9e-16 ref|XP_002515929.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 ref|XP_010654585.1| PREDICTED: uncharacterized protein LOC100248... 57 5e-06 >emb|CDP12314.1| unnamed protein product [Coffea canephora] Length = 77 Score = 90.9 bits (224), Expect = 3e-16 Identities = 44/75 (58%), Positives = 56/75 (74%), Gaps = 5/75 (6%) Frame = -3 Query: 378 AKLSPASFLVT-FLIFGILLSTVMLCNAAG---LTYRELVQKPSCPPCLCCQTAKPPP-C 214 AK S S LV F+IF IL+S+ + +AAG LT+RE++QKPSCPPC+CC PPP C Sbjct: 3 AKSSQESLLVVAFVIFAILVSSTIPSHAAGSSGLTHREIMQKPSCPPCICCHKELPPPDC 62 Query: 213 CYCACFVTQSGNKIP 169 CYCAC+VT+SGN+ P Sbjct: 63 CYCACYVTESGNEAP 77 >emb|CDO97956.1| unnamed protein product [Coffea canephora] Length = 78 Score = 89.4 bits (220), Expect = 9e-16 Identities = 46/76 (60%), Positives = 53/76 (69%), Gaps = 6/76 (7%) Frame = -3 Query: 378 AKLSPASFLVTFLIFGILL--STVMLCNAAG---LTYRELVQKPSCPPCLCCQTAKPPP- 217 A S S +V +IF IL+ ST+ AAG LT+REL+QKP CPPCLCCQ PPP Sbjct: 3 ANSSQESLVVASVIFAILILSSTIPPALAAGITGLTHRELMQKPHCPPCLCCQRKLPPPE 62 Query: 216 CCYCACFVTQSGNKIP 169 CCYCACFVT+SGNK P Sbjct: 63 CCYCACFVTESGNKAP 78 >ref|XP_002515929.1| conserved hypothetical protein [Ricinus communis] gi|223544834|gb|EEF46349.1| conserved hypothetical protein [Ricinus communis] Length = 75 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/75 (42%), Positives = 42/75 (56%), Gaps = 4/75 (5%) Frame = -3 Query: 381 MAKLSPASFLVTFLIFGILLSTVMLCNAAGLTYRELVQ--KPSCPPCLCCQTAKPPPCCY 208 MA S S VTFL+F ++LS ++ AA L +R+L+Q P CP C+CC P CC Sbjct: 1 MATNSLKSSFVTFLVFAMILSPIIPSEAARLNHRDLLQTRPPICPACVCCAPPPPGSCCR 60 Query: 207 CAC--FVTQSGNKIP 169 C VT+S N P Sbjct: 61 CCASPIVTESTNGSP 75 >ref|XP_010654585.1| PREDICTED: uncharacterized protein LOC100248142 [Vitis vinifera] Length = 74 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 4/59 (6%) Frame = -3 Query: 369 SPASFLVTFLIFGILLST-VMLCNAAGLTYRELVQK---PSCPPCLCCQTAKPPPCCYC 205 SP S L+T IF ++LS V C+AA T REL+Q+ P CP C+CC A P CC C Sbjct: 6 SPRSILLTIFIFAMVLSPMVSSCDAARFTQRELLQEDEGPICPACVCCSPAPPGGCCPC 64