BLASTX nr result
ID: Forsythia21_contig00025002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00025002 (240 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ70533.1| hypothetical protein M436DRAFT_75356 [Aureobasidi... 56 8e-06 >gb|KEQ70533.1| hypothetical protein M436DRAFT_75356 [Aureobasidium namibiae CBS 147.97] Length = 224 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = -1 Query: 102 MTDTEIKEGDKVAWQWGGGKPGGVAAEVATEGEI 1 MTD EIKEGD+V+WQW G +PGG ++VA EGE+ Sbjct: 1 MTDKEIKEGDQVSWQWSGSRPGGTVSDVAKEGEL 34