BLASTX nr result
ID: Forsythia21_contig00023344
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00023344 (221 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KER00687.1| hypothetical protein AUEXF2481DRAFT_596 [Aureobas... 103 4e-20 gb|KEQ69022.1| UPF0057-domain-containing protein [Aureobasidium ... 103 6e-20 gb|KEQ87443.1| UPF0057-domain-containing protein [Aureobasidium ... 102 1e-19 gb|EME50198.1| hypothetical protein DOTSEDRAFT_41329 [Dothistrom... 102 1e-19 ref|XP_007674090.1| hypothetical protein BAUCODRAFT_389265 [Baud... 102 1e-19 ref|XP_007920816.1| hypothetical protein MYCFIDRAFT_180921 [Pseu... 102 1e-19 ref|XP_009226059.1| plasma membrane proteolipid 3 [Gaeumannomyce... 102 1e-19 gb|KEQ59816.1| UPF0057-domain-containing protein [Aureobasidium ... 101 2e-19 gb|KIO19944.1| hypothetical protein M407DRAFT_245993 [Tulasnella... 100 4e-19 ref|XP_003856424.1| hypothetical protein MYCGRDRAFT_78728 [Zymos... 100 6e-19 gb|EMF17724.1| UPF0057-domain-containing protein [Sphaerulina mu... 99 8e-19 ref|XP_001910957.1| hypothetical protein [Podospora anserina S m... 99 8e-19 ref|XP_001547873.1| conserved hypothetical protein [Botrytis cin... 99 8e-19 ref|XP_001588788.1| hypothetical protein SS1G_10335 [Sclerotinia... 99 1e-18 ref|XP_003719726.1| plasma membrane proteolipid 3 [Magnaporthe o... 99 1e-18 gb|KIM28882.1| hypothetical protein M408DRAFT_69196 [Serendipita... 98 2e-18 emb|CCU76326.1| plasma membrane proteolipid 3 [Blumeria graminis... 98 2e-18 dbj|GAM82162.1| hypothetical protein ANO11243_001410 [fungal sp.... 97 3e-18 gb|ERS97669.1| plasma membrane proteolipid 3 [Sporothrix schenck... 97 3e-18 gb|EHK25550.1| hypothetical protein TRIVIDRAFT_72673 [Trichoderm... 97 3e-18 >gb|KER00687.1| hypothetical protein AUEXF2481DRAFT_596 [Aureobasidium subglaciale EXF-2481] Length = 57 Score = 103 bits (257), Expect = 4e-20 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 MPFTGSDIIKII A+VLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY Sbjct: 1 MPFTGSDIIKIIIAIVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 52 >gb|KEQ69022.1| UPF0057-domain-containing protein [Aureobasidium namibiae CBS 147.97] Length = 57 Score = 103 bits (256), Expect = 6e-20 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 MPFTGSDIIKII A++LPPLGVFLERGCGADLLINILLTILGYIPGIIHALY Sbjct: 1 MPFTGSDIIKIIIAIILPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 52 >gb|KEQ87443.1| UPF0057-domain-containing protein [Aureobasidium pullulans EXF-150] Length = 57 Score = 102 bits (254), Expect = 1e-19 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 MPFTGSDIIKII A++LPPLGVFLERGCGADLLIN+LLTILGYIPGIIHALY Sbjct: 1 MPFTGSDIIKIIIAIILPPLGVFLERGCGADLLINLLLTILGYIPGIIHALY 52 >gb|EME50198.1| hypothetical protein DOTSEDRAFT_41329 [Dothistroma septosporum NZE10] Length = 57 Score = 102 bits (254), Expect = 1e-19 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 MPFTGSDIIKII A++LPPLGVFLERGCGADLLINILLTILGYIPGIIHALY Sbjct: 1 MPFTGSDIIKIILAILLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 52 >ref|XP_007674090.1| hypothetical protein BAUCODRAFT_389265 [Baudoinia compniacensis UAMH 10762] gi|449303043|gb|EMC99051.1| hypothetical protein BAUCODRAFT_389265 [Baudoinia compniacensis UAMH 10762] Length = 57 Score = 102 bits (254), Expect = 1e-19 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 MPFTGSDIIKII A++LPPLGVFLERGCGADLLINILLTILGYIPGIIHALY Sbjct: 1 MPFTGSDIIKIIVAILLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 52 >ref|XP_007920816.1| hypothetical protein MYCFIDRAFT_180921 [Pseudocercospora fijiensis CIRAD86] gi|452987580|gb|EME87335.1| hypothetical protein MYCFIDRAFT_180921 [Pseudocercospora fijiensis CIRAD86] Length = 57 Score = 102 bits (253), Expect = 1e-19 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 MPFTGSDIIKII A++LPPLGVFLERGCGADLLINILLTILGYIPGIIHALY Sbjct: 1 MPFTGSDIIKIIFAILLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 52 >ref|XP_009226059.1| plasma membrane proteolipid 3 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|402077736|gb|EJT73085.1| plasma membrane proteolipid 3 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 83 Score = 102 bits (253), Expect = 1e-19 Identities = 52/76 (68%), Positives = 58/76 (76%), Gaps = 6/76 (7%) Frame = -2 Query: 211 TFSNTNNQSPDYPSNT------ASMPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINI 50 TF +QSP + A+MPFT SDI KII AV+LPPLGVFLERGCGADLLINI Sbjct: 3 TFLAAEHQSPKHKQTQPDTDTPANMPFTASDICKIILAVILPPLGVFLERGCGADLLINI 62 Query: 49 LLTILGYIPGIIHALY 2 LLT+LGY+PGIIHALY Sbjct: 63 LLTLLGYLPGIIHALY 78 >gb|KEQ59816.1| UPF0057-domain-containing protein [Aureobasidium melanogenum CBS 110374] Length = 57 Score = 101 bits (252), Expect = 2e-19 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 MPFTGSDIIKII A++LPPLGVFLERGCGAD LINILLTILGYIPGIIHALY Sbjct: 1 MPFTGSDIIKIILAIILPPLGVFLERGCGADFLINILLTILGYIPGIIHALY 52 >gb|KIO19944.1| hypothetical protein M407DRAFT_245993 [Tulasnella calospora MUT 4182] Length = 57 Score = 100 bits (249), Expect = 4e-19 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 M FTG DI+KIICAVVLPPLGVF ERGCGADLLINILLT+LGYIPGIIHALY Sbjct: 1 MAFTGGDILKIICAVVLPPLGVFFERGCGADLLINILLTVLGYIPGIIHALY 52 >ref|XP_003856424.1| hypothetical protein MYCGRDRAFT_78728 [Zymoseptoria tritici IPO323] gi|339476309|gb|EGP91400.1| hypothetical protein MYCGRDRAFT_78728 [Zymoseptoria tritici IPO323] gi|796705391|gb|KJX97074.1| plasma membrane proteolipid 3 like protein [Zymoseptoria brevis] Length = 57 Score = 99.8 bits (247), Expect = 6e-19 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 MPFTGSDIIKII A+ +PP+GVFLERGCGADLLINILLTILGYIPGIIHALY Sbjct: 1 MPFTGSDIIKIIFAIFIPPIGVFLERGCGADLLINILLTILGYIPGIIHALY 52 >gb|EMF17724.1| UPF0057-domain-containing protein [Sphaerulina musiva SO2202] Length = 57 Score = 99.4 bits (246), Expect = 8e-19 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 MPFTGSDIIKII A+ +PP+GVFLERGCGADLLINILLTILGYIPGIIHALY Sbjct: 1 MPFTGSDIIKIIFAIFIPPVGVFLERGCGADLLINILLTILGYIPGIIHALY 52 >ref|XP_001910957.1| hypothetical protein [Podospora anserina S mat+] gi|170945981|emb|CAP72782.1| unnamed protein product [Podospora anserina S mat+] gi|681095051|emb|CDP25180.1| Putative plasma membrane proteolipid 3 [Podospora anserina S mat+] Length = 57 Score = 99.4 bits (246), Expect = 8e-19 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 MPFTGSDI KII AV+LPPLGVFLERGCGADLLIN+LLTILGYIPGI+HALY Sbjct: 1 MPFTGSDICKIIFAVLLPPLGVFLERGCGADLLINLLLTILGYIPGIVHALY 52 >ref|XP_001547873.1| conserved hypothetical protein [Botrytis cinerea B05.10] gi|347835463|emb|CCD50035.1| similar to stress response RCI peptide [Botrytis cinerea T4] Length = 57 Score = 99.4 bits (246), Expect = 8e-19 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 MPFT SDI KII AV+LPPLGVFLERGCGADLLINILLTILGYIPGIIHALY Sbjct: 1 MPFTASDICKIILAVILPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 52 >ref|XP_001588788.1| hypothetical protein SS1G_10335 [Sclerotinia sclerotiorum 1980] gi|154694724|gb|EDN94462.1| hypothetical protein SS1G_10335 [Sclerotinia sclerotiorum 1980 UF-70] Length = 57 Score = 99.0 bits (245), Expect = 1e-18 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 MPFT SDI KII A++LPPLGVFLERGCGADLLINILLTILGYIPGIIHALY Sbjct: 1 MPFTASDICKIILAIILPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 52 >ref|XP_003719726.1| plasma membrane proteolipid 3 [Magnaporthe oryzae 70-15] gi|351639495|gb|EHA47359.1| plasma membrane proteolipid 3 [Magnaporthe oryzae 70-15] gi|440472934|gb|ELQ41764.1| hypothetical protein OOU_Y34scaffold00255g62 [Magnaporthe oryzae Y34] gi|440478702|gb|ELQ59512.1| hypothetical protein OOW_P131scaffold01349g18 [Magnaporthe oryzae P131] Length = 57 Score = 98.6 bits (244), Expect = 1e-18 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 MPFT SDI KII AV+LPPLGVF+ERGCGADLLINILLTILGYIPGIIHALY Sbjct: 1 MPFTASDICKIILAVILPPLGVFMERGCGADLLINILLTILGYIPGIIHALY 52 >gb|KIM28882.1| hypothetical protein M408DRAFT_69196 [Serendipita vermifera MAFF 305830] Length = 57 Score = 97.8 bits (242), Expect = 2e-18 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 MPFTGSDIIKII A+ LPP+GVFLERGCG DL+INILLTILGYIPGIIHALY Sbjct: 1 MPFTGSDIIKIILAIFLPPVGVFLERGCGGDLVINILLTILGYIPGIIHALY 52 >emb|CCU76326.1| plasma membrane proteolipid 3 [Blumeria graminis f. sp. hordei DH14] Length = 57 Score = 97.8 bits (242), Expect = 2e-18 Identities = 47/52 (90%), Positives = 48/52 (92%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 MPFT SDI KII AV+LPPLGVFLERGCG DLLINILLTILGYIPGIIHALY Sbjct: 1 MPFTASDIFKIILAVILPPLGVFLERGCGPDLLINILLTILGYIPGIIHALY 52 >dbj|GAM82162.1| hypothetical protein ANO11243_001410 [fungal sp. No.11243] Length = 57 Score = 97.4 bits (241), Expect = 3e-18 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 MPFT SDIIKII A++LPPLGVFLERGCGADLLINILLT+L YIPGIIHALY Sbjct: 1 MPFTASDIIKIIFAIILPPLGVFLERGCGADLLINILLTLLAYIPGIIHALY 52 >gb|ERS97669.1| plasma membrane proteolipid 3 [Sporothrix schenckii ATCC 58251] gi|780591434|gb|KJR82193.1| hypothetical protein SPSK_10959 [Sporothrix schenckii 1099-18] Length = 57 Score = 97.4 bits (241), Expect = 3e-18 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 MPFT SDI KII A++LPPLGVFLERGCGADLLINILLTILGYIPGI+HALY Sbjct: 1 MPFTTSDICKIILAIILPPLGVFLERGCGADLLINILLTILGYIPGILHALY 52 >gb|EHK25550.1| hypothetical protein TRIVIDRAFT_72673 [Trichoderma virens Gv29-8] Length = 57 Score = 97.4 bits (241), Expect = 3e-18 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = -2 Query: 157 MPFTGSDIIKIICAVVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALY 2 MPFT SDI KI+ A++LPP+GVFLERGCGADLLINILLTILGYIPGIIHALY Sbjct: 1 MPFTASDICKILLAIILPPIGVFLERGCGADLLINILLTILGYIPGIIHALY 52