BLASTX nr result
ID: Forsythia21_contig00023280
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00023280 (192 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003842574.1| similar to elongation factor 3 [Leptosphaeri... 124 2e-26 ref|XP_003302590.1| hypothetical protein PTT_14468 [Pyrenophora ... 124 2e-26 ref|XP_001935358.1| elongation factor 3 [Pyrenophora tritici-rep... 124 2e-26 ref|XP_007687186.1| hypothetical protein COCMIDRAFT_93149 [Bipol... 123 4e-26 ref|XP_007717913.1| hypothetical protein COCCADRAFT_9710 [Bipola... 123 4e-26 ref|XP_008026215.1| hypothetical protein SETTUDRAFT_169329 [Seto... 123 4e-26 gb|EMD85993.1| hypothetical protein COCHEDRAFT_32591 [Bipolaris ... 123 4e-26 ref|XP_001796257.1| hypothetical protein SNOG_05861 [Phaeosphaer... 122 7e-26 ref|XP_007701745.1| hypothetical protein COCSADRAFT_146029 [Bipo... 122 1e-25 emb|CEJ62198.1| Putative Elongation factor 3 [Penicillium brasil... 118 1e-24 gb|EPS34293.1| hypothetical protein PDE_09257 [Penicillium oxali... 118 1e-24 dbj|GAO86505.1| elongation factor 3 [Neosartorya udagawae] 117 2e-24 gb|KEY75508.1| translation elongation factor eEF 3 [Aspergillus ... 117 2e-24 ref|XP_748943.1| translation elongation factor eEF-3 [Aspergillu... 117 2e-24 ref|XP_001261514.1| elongation factor [Neosartorya fischeri NRRL... 117 2e-24 ref|XP_001273393.1| elongation factor [Aspergillus clavatus NRRL... 117 2e-24 ref|XP_007778945.1| elongation factor 3 [Coniosporium apollinis ... 117 3e-24 dbj|GAM84451.1| hypothetical protein ANO11243_024470 [fungal sp.... 117 4e-24 gb|KEQ97940.1| hypothetical protein AUEXF2481DRAFT_2842 [Aureoba... 116 5e-24 gb|KEQ83925.1| elongation factor 3 [Aureobasidium pullulans EXF-... 116 5e-24 >ref|XP_003842574.1| similar to elongation factor 3 [Leptosphaeria maculans JN3] gi|312219151|emb|CBX99095.1| similar to elongation factor 3 [Leptosphaeria maculans JN3] Length = 1063 Score = 124 bits (312), Expect = 2e-26 Identities = 58/63 (92%), Positives = 61/63 (96%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSI+ISHDS FL+ VIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHEL+ASDMEFKF Sbjct: 611 CTSIVISHDSKFLNNVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELSASDMEFKF 670 Query: 183 PEP 191 PEP Sbjct: 671 PEP 673 >ref|XP_003302590.1| hypothetical protein PTT_14468 [Pyrenophora teres f. teres 0-1] gi|311321923|gb|EFQ89291.1| hypothetical protein PTT_14468 [Pyrenophora teres f. teres 0-1] Length = 1057 Score = 124 bits (312), Expect = 2e-26 Identities = 58/63 (92%), Positives = 61/63 (96%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSI+ISHDS FL+ VIQHVIHYERFKLKRYRGNLDDFVKRVP+AKSYHELAASDMEFKF Sbjct: 612 CTSIVISHDSKFLNNVIQHVIHYERFKLKRYRGNLDDFVKRVPAAKSYHELAASDMEFKF 671 Query: 183 PEP 191 PEP Sbjct: 672 PEP 674 >ref|XP_001935358.1| elongation factor 3 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187981306|gb|EDU47932.1| elongation factor 3 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1064 Score = 124 bits (312), Expect = 2e-26 Identities = 58/63 (92%), Positives = 61/63 (96%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSI+ISHDS FL+ VIQHVIHYERFKLKRYRGNLDDFVKRVP+AKSYHELAASDMEFKF Sbjct: 612 CTSIVISHDSKFLNNVIQHVIHYERFKLKRYRGNLDDFVKRVPAAKSYHELAASDMEFKF 671 Query: 183 PEP 191 PEP Sbjct: 672 PEP 674 >ref|XP_007687186.1| hypothetical protein COCMIDRAFT_93149 [Bipolaris oryzae ATCC 44560] gi|576932793|gb|EUC46329.1| hypothetical protein COCMIDRAFT_93149 [Bipolaris oryzae ATCC 44560] Length = 1064 Score = 123 bits (309), Expect = 4e-26 Identities = 57/63 (90%), Positives = 61/63 (96%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSI+ISHDS FL+ VIQHVIHYERFKLKRY+GNLDDFVKRVPSAKSYHEL+ASDMEFKF Sbjct: 612 CTSIVISHDSKFLNNVIQHVIHYERFKLKRYKGNLDDFVKRVPSAKSYHELSASDMEFKF 671 Query: 183 PEP 191 PEP Sbjct: 672 PEP 674 >ref|XP_007717913.1| hypothetical protein COCCADRAFT_9710 [Bipolaris zeicola 26-R-13] gi|576913332|gb|EUC27778.1| hypothetical protein COCCADRAFT_9710 [Bipolaris zeicola 26-R-13] gi|578485355|gb|EUN22853.1| hypothetical protein COCVIDRAFT_30166 [Bipolaris victoriae FI3] Length = 1064 Score = 123 bits (309), Expect = 4e-26 Identities = 57/63 (90%), Positives = 61/63 (96%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSI+ISHDS FL+ VIQHVIHYERFKLKRY+GNLDDFVKRVPSAKSYHEL+ASDMEFKF Sbjct: 612 CTSIVISHDSKFLNNVIQHVIHYERFKLKRYKGNLDDFVKRVPSAKSYHELSASDMEFKF 671 Query: 183 PEP 191 PEP Sbjct: 672 PEP 674 >ref|XP_008026215.1| hypothetical protein SETTUDRAFT_169329 [Setosphaeria turcica Et28A] gi|482809402|gb|EOA86224.1| hypothetical protein SETTUDRAFT_169329 [Setosphaeria turcica Et28A] Length = 1064 Score = 123 bits (309), Expect = 4e-26 Identities = 57/63 (90%), Positives = 61/63 (96%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSI+ISHDS FL+ VIQHVIHYERFKLKRY+GNLDDFVKRVPSAKSYHEL+ASDMEFKF Sbjct: 612 CTSIVISHDSKFLNNVIQHVIHYERFKLKRYKGNLDDFVKRVPSAKSYHELSASDMEFKF 671 Query: 183 PEP 191 PEP Sbjct: 672 PEP 674 >gb|EMD85993.1| hypothetical protein COCHEDRAFT_32591 [Bipolaris maydis C5] gi|477584907|gb|ENI01997.1| hypothetical protein COCC4DRAFT_52675 [Bipolaris maydis ATCC 48331] Length = 1064 Score = 123 bits (309), Expect = 4e-26 Identities = 57/63 (90%), Positives = 61/63 (96%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSI+ISHDS FL+ VIQHVIHYERFKLKRY+GNLDDFVKRVPSAKSYHEL+ASDMEFKF Sbjct: 612 CTSIVISHDSKFLNNVIQHVIHYERFKLKRYKGNLDDFVKRVPSAKSYHELSASDMEFKF 671 Query: 183 PEP 191 PEP Sbjct: 672 PEP 674 >ref|XP_001796257.1| hypothetical protein SNOG_05861 [Phaeosphaeria nodorum SN15] gi|111065805|gb|EAT86925.1| hypothetical protein SNOG_05861 [Phaeosphaeria nodorum SN15] Length = 1064 Score = 122 bits (307), Expect = 7e-26 Identities = 56/63 (88%), Positives = 61/63 (96%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSI+ISHDS FL+ +IQHVIHYERFKLKRYRGNLD+FVKRVPSAKSYHEL+ASDMEFKF Sbjct: 612 CTSIVISHDSKFLNNIIQHVIHYERFKLKRYRGNLDEFVKRVPSAKSYHELSASDMEFKF 671 Query: 183 PEP 191 PEP Sbjct: 672 PEP 674 >ref|XP_007701745.1| hypothetical protein COCSADRAFT_146029 [Bipolaris sorokiniana ND90Pr] gi|451849043|gb|EMD62347.1| hypothetical protein COCSADRAFT_146029 [Bipolaris sorokiniana ND90Pr] Length = 1064 Score = 122 bits (305), Expect = 1e-25 Identities = 55/63 (87%), Positives = 61/63 (96%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSI+ISHDS FL+ +IQHVIHYERFKLKRY+GNLDDFVKRVPSAKSYHEL+ASDMEF+F Sbjct: 612 CTSIVISHDSKFLNNIIQHVIHYERFKLKRYKGNLDDFVKRVPSAKSYHELSASDMEFRF 671 Query: 183 PEP 191 PEP Sbjct: 672 PEP 674 >emb|CEJ62198.1| Putative Elongation factor 3 [Penicillium brasilianum] Length = 1068 Score = 118 bits (296), Expect = 1e-24 Identities = 53/63 (84%), Positives = 60/63 (95%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSI++SHDSGFLDRVIQHV+HYERFKLKRYRG L +FVKRVPSA+SY+EL AS+MEFKF Sbjct: 616 CTSIMVSHDSGFLDRVIQHVVHYERFKLKRYRGTLSEFVKRVPSARSYYELGASEMEFKF 675 Query: 183 PEP 191 PEP Sbjct: 676 PEP 678 >gb|EPS34293.1| hypothetical protein PDE_09257 [Penicillium oxalicum 114-2] Length = 1068 Score = 118 bits (296), Expect = 1e-24 Identities = 53/63 (84%), Positives = 60/63 (95%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSI++SHDSGFLDRVIQHV+HYERFKLKRYRG L +FVKRVPSA+SY+EL AS+MEFKF Sbjct: 616 CTSIMVSHDSGFLDRVIQHVVHYERFKLKRYRGTLSEFVKRVPSARSYYELGASEMEFKF 675 Query: 183 PEP 191 PEP Sbjct: 676 PEP 678 >dbj|GAO86505.1| elongation factor 3 [Neosartorya udagawae] Length = 1065 Score = 117 bits (294), Expect = 2e-24 Identities = 53/63 (84%), Positives = 60/63 (95%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSII+SHDS FLD VIQHV+HYERFKLKRYRGNL +FVK+VPSA+SY+EL+ASDMEFKF Sbjct: 614 CTSIIVSHDSKFLDNVIQHVVHYERFKLKRYRGNLSEFVKKVPSARSYYELSASDMEFKF 673 Query: 183 PEP 191 PEP Sbjct: 674 PEP 676 >gb|KEY75508.1| translation elongation factor eEF 3 [Aspergillus fumigatus var. RP-2014] Length = 1052 Score = 117 bits (294), Expect = 2e-24 Identities = 53/63 (84%), Positives = 60/63 (95%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSII+SHDS FLD VIQHV+HYERFKLKRYRGNL +FVK+VPSA+SY+EL+ASDMEFKF Sbjct: 614 CTSIIVSHDSKFLDNVIQHVVHYERFKLKRYRGNLSEFVKKVPSARSYYELSASDMEFKF 673 Query: 183 PEP 191 PEP Sbjct: 674 PEP 676 >ref|XP_748943.1| translation elongation factor eEF-3 [Aspergillus fumigatus Af293] gi|66846573|gb|EAL86905.1| translation elongation factor eEF-3, putative [Aspergillus fumigatus Af293] gi|159123287|gb|EDP48407.1| translation elongation factor eEF-3, putative [Aspergillus fumigatus A1163] gi|846910243|gb|KMK56170.1| translation elongation factor eEF-3 [Aspergillus fumigatus Z5] Length = 1065 Score = 117 bits (294), Expect = 2e-24 Identities = 53/63 (84%), Positives = 60/63 (95%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSII+SHDS FLD VIQHV+HYERFKLKRYRGNL +FVK+VPSA+SY+EL+ASDMEFKF Sbjct: 614 CTSIIVSHDSKFLDNVIQHVVHYERFKLKRYRGNLSEFVKKVPSARSYYELSASDMEFKF 673 Query: 183 PEP 191 PEP Sbjct: 674 PEP 676 >ref|XP_001261514.1| elongation factor [Neosartorya fischeri NRRL 181] gi|119409669|gb|EAW19617.1| elongation factor [Neosartorya fischeri NRRL 181] Length = 1065 Score = 117 bits (294), Expect = 2e-24 Identities = 53/63 (84%), Positives = 60/63 (95%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSII+SHDS FLD VIQHV+HYERFKLKRYRGNL +FVK+VPSA+SY+EL+ASDMEFKF Sbjct: 614 CTSIIVSHDSKFLDNVIQHVVHYERFKLKRYRGNLSEFVKKVPSARSYYELSASDMEFKF 673 Query: 183 PEP 191 PEP Sbjct: 674 PEP 676 >ref|XP_001273393.1| elongation factor [Aspergillus clavatus NRRL 1] gi|119401544|gb|EAW11967.1| elongation factor [Aspergillus clavatus NRRL 1] Length = 1065 Score = 117 bits (294), Expect = 2e-24 Identities = 53/63 (84%), Positives = 60/63 (95%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSII+SHDS FLD VIQHV+HYERFKLKRYRGNL +FVK+VPSA+SY+EL+ASDMEFKF Sbjct: 614 CTSIIVSHDSKFLDNVIQHVVHYERFKLKRYRGNLSEFVKKVPSARSYYELSASDMEFKF 673 Query: 183 PEP 191 PEP Sbjct: 674 PEP 676 >ref|XP_007778945.1| elongation factor 3 [Coniosporium apollinis CBS 100218] gi|494826572|gb|EON63628.1| elongation factor 3 [Coniosporium apollinis CBS 100218] Length = 1062 Score = 117 bits (293), Expect = 3e-24 Identities = 55/63 (87%), Positives = 59/63 (93%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSIIISHDS FLD VIQHVIHYERFKLKRYRG+L +FVKRVPSA+SY+EL ASDMEFKF Sbjct: 620 CTSIIISHDSRFLDHVIQHVIHYERFKLKRYRGSLSEFVKRVPSARSYYELGASDMEFKF 679 Query: 183 PEP 191 PEP Sbjct: 680 PEP 682 >dbj|GAM84451.1| hypothetical protein ANO11243_024470 [fungal sp. No.11243] Length = 1071 Score = 117 bits (292), Expect = 4e-24 Identities = 53/63 (84%), Positives = 59/63 (93%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSIIISHDS FLD V+QHVIHYERFKLKRYRGNL +FVKRVPSA+SYHEL+AS++EF F Sbjct: 620 CTSIIISHDSKFLDNVVQHVIHYERFKLKRYRGNLSEFVKRVPSARSYHELSASELEFNF 679 Query: 183 PEP 191 PEP Sbjct: 680 PEP 682 >gb|KEQ97940.1| hypothetical protein AUEXF2481DRAFT_2842 [Aureobasidium subglaciale EXF-2481] Length = 1055 Score = 116 bits (291), Expect = 5e-24 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSIIISHDS FLD VIQHVIHYERFKLKRYRG L +FVKRVPSAKSY+EL AS+MEFKF Sbjct: 602 CTSIIISHDSRFLDNVIQHVIHYERFKLKRYRGKLSEFVKRVPSAKSYYELGASEMEFKF 661 Query: 183 PEP 191 PEP Sbjct: 662 PEP 664 >gb|KEQ83925.1| elongation factor 3 [Aureobasidium pullulans EXF-150] Length = 1059 Score = 116 bits (291), Expect = 5e-24 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = +3 Query: 3 CTSIIISHDSGFLDRVIQHVIHYERFKLKRYRGNLDDFVKRVPSAKSYHELAASDMEFKF 182 CTSIIISHDS FLD VIQHVIHYERFKLKRYRG L +FVKRVPSAKSY+EL AS+MEFKF Sbjct: 606 CTSIIISHDSKFLDNVIQHVIHYERFKLKRYRGKLSEFVKRVPSAKSYYELGASEMEFKF 665 Query: 183 PEP 191 PEP Sbjct: 666 PEP 668