BLASTX nr result
ID: Forsythia21_contig00023167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00023167 (410 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003305426.1| hypothetical protein PTT_18263 [Pyrenophora ... 86 1e-14 ref|XP_001934729.1| GPI-anchored cell wall organization protein ... 84 5e-14 ref|XP_003835586.1| hypothetical protein LEMA_P049270.1 [Leptosp... 61 3e-07 >ref|XP_003305426.1| hypothetical protein PTT_18263 [Pyrenophora teres f. teres 0-1] gi|311317567|gb|EFQ86486.1| hypothetical protein PTT_18263 [Pyrenophora teres f. teres 0-1] Length = 394 Score = 85.5 bits (210), Expect = 1e-14 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +2 Query: 2 VTETCATYKPLKEKKLIEGGYKCEGKLIDPAGEGHKGTKQGG 127 VTETCA YKPLK KKLI+GGYKCEGKLIDPAGEGH GTKQGG Sbjct: 322 VTETCAFYKPLKSKKLIQGGYKCEGKLIDPAGEGHSGTKQGG 363 >ref|XP_001934729.1| GPI-anchored cell wall organization protein Ecm33 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187980608|gb|EDU47234.1| GPI-anchored cell wall organization protein Ecm33 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 392 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +2 Query: 2 VTETCATYKPLKEKKLIEGGYKCEGKLIDPAGEGHKGTKQGG 127 VTETCA Y+PLK KKLI+GGYKCEGKLIDPAGEGH GTKQGG Sbjct: 322 VTETCAFYQPLKSKKLIQGGYKCEGKLIDPAGEGHTGTKQGG 363 >ref|XP_003835586.1| hypothetical protein LEMA_P049270.1 [Leptosphaeria maculans JN3] gi|312212137|emb|CBX92221.1| hypothetical protein LEMA_P049270.1 [Leptosphaeria maculans JN3] Length = 394 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = +2 Query: 2 VTETCATYKPLKEKKLIEGGYKCEGKLIDPAGEGHKGTKQGG 127 VT CA YKPLK+KKLI GGY C GK+ DP EGH+ T Q G Sbjct: 322 VTAACAFYKPLKDKKLIRGGYFCRGKVEDPGQEGHRPTDQSG 363