BLASTX nr result
ID: Forsythia21_contig00022772
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00022772 (208 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIX95793.1| 40S ribosomal protein S9 [Fonsecaea multimorphosa... 133 5e-29 gb|KIX06477.1| 40S ribosomal protein S9 [Rhinocladiella mackenzi... 133 5e-29 gb|KIW73335.1| 40S ribosomal protein S9 [Capronia semiimmersa] 133 5e-29 gb|KIW44874.1| 40S ribosomal protein S9 [Exophiala oligosperma] 133 5e-29 gb|KIW24305.1| 40S ribosomal protein S9 [Cladophialophora immunda] 133 5e-29 gb|KIW15420.1| 40S ribosomal protein S9 [Exophiala spinifera] 133 5e-29 gb|KIW07901.1| 40S ribosomal protein S9 [Verruconis gallopava] 133 5e-29 gb|KIV89206.1| 40S ribosomal protein S9 [Exophiala mesophila] 133 5e-29 gb|KIV80024.1| 40S ribosomal protein S9 [Exophiala sideris] 133 5e-29 dbj|GAM87141.1| hypothetical protein ANO11243_051620 [fungal sp.... 133 5e-29 ref|XP_007724904.1| 40S ribosomal protein S9 [Capronia coronata ... 133 5e-29 ref|XP_007752813.1| 40S ribosomal protein S9 [Cladophialophora y... 133 5e-29 ref|XP_007750565.1| 40S ribosomal protein S9 [Cladophialophora p... 133 5e-29 ref|XP_008711137.1| 40S ribosomal protein S9 [Cyphellophora euro... 133 5e-29 ref|XP_008722253.1| 40S ribosomal protein S9 [Cladophialophora c... 133 5e-29 dbj|GAD92307.1| 40S ribosomal protein S9 [Byssochlamys spectabil... 133 5e-29 ref|XP_007587858.1| putative 40s ribosomal protein s9 protein [N... 133 5e-29 gb|EME38681.1| ribosomal protein S9-like protein [Dothistroma se... 133 5e-29 gb|EKG11582.1| Ribosomal protein S4/S9 [Macrophomina phaseolina ... 133 5e-29 ref|XP_009155008.1| 40S ribosomal protein S9 [Exophiala dermatit... 133 5e-29 >gb|KIX95793.1| 40S ribosomal protein S9 [Fonsecaea multimorphosa CBS 102226] Length = 193 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 133 RVGKQIVN 140 >gb|KIX06477.1| 40S ribosomal protein S9 [Rhinocladiella mackenziei CBS 650.93] Length = 193 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 133 RVGKQIVN 140 >gb|KIW73335.1| 40S ribosomal protein S9 [Capronia semiimmersa] Length = 193 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 133 RVGKQIVN 140 >gb|KIW44874.1| 40S ribosomal protein S9 [Exophiala oligosperma] Length = 193 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 133 RVGKQIVN 140 >gb|KIW24305.1| 40S ribosomal protein S9 [Cladophialophora immunda] Length = 193 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 133 RVGKQIVN 140 >gb|KIW15420.1| 40S ribosomal protein S9 [Exophiala spinifera] Length = 193 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 133 RVGKQIVN 140 >gb|KIW07901.1| 40S ribosomal protein S9 [Verruconis gallopava] Length = 191 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 133 RVGKQIVN 140 >gb|KIV89206.1| 40S ribosomal protein S9 [Exophiala mesophila] Length = 193 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 133 RVGKQIVN 140 >gb|KIV80024.1| 40S ribosomal protein S9 [Exophiala sideris] Length = 193 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 133 RVGKQIVN 140 >dbj|GAM87141.1| hypothetical protein ANO11243_051620 [fungal sp. No.11243] Length = 192 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 133 RVGKQIVN 140 >ref|XP_007724904.1| 40S ribosomal protein S9 [Capronia coronata CBS 617.96] gi|590010261|gb|EXJ85466.1| 40S ribosomal protein S9 [Capronia coronata CBS 617.96] Length = 193 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 133 RVGKQIVN 140 >ref|XP_007752813.1| 40S ribosomal protein S9 [Cladophialophora yegresii CBS 114405] gi|589981005|gb|EXJ64246.1| 40S ribosomal protein S9 [Cladophialophora yegresii CBS 114405] Length = 196 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 76 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 135 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 136 RVGKQIVN 143 >ref|XP_007750565.1| 40S ribosomal protein S9 [Cladophialophora psammophila CBS 110553] gi|589978218|gb|EXJ61489.1| 40S ribosomal protein S9 [Cladophialophora psammophila CBS 110553] gi|759319470|gb|KIW95815.1| 40S ribosomal protein S9 [Cladophialophora bantiana CBS 173.52] Length = 192 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 133 RVGKQIVN 140 >ref|XP_008711137.1| 40S ribosomal protein S9 [Cyphellophora europaea CBS 101466] gi|568123840|gb|ETN46425.1| 40S ribosomal protein S9 [Cyphellophora europaea CBS 101466] Length = 195 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 133 RVGKQIVN 140 >ref|XP_008722253.1| 40S ribosomal protein S9 [Cladophialophora carrionii CBS 160.54] gi|565939073|gb|ETI28179.1| 40S ribosomal protein S9 [Cladophialophora carrionii CBS 160.54] Length = 193 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 133 RVGKQIVN 140 >dbj|GAD92307.1| 40S ribosomal protein S9 [Byssochlamys spectabilis No. 5] Length = 204 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 86 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 145 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 146 RVGKQIVN 153 >ref|XP_007587858.1| putative 40s ribosomal protein s9 protein [Neofusicoccum parvum UCRNP2] gi|485917877|gb|EOD44674.1| putative 40s ribosomal protein s9 protein [Neofusicoccum parvum UCRNP2] gi|821074084|gb|KKY28979.1| putative 40s ribosomal protein s9 [Diplodia seriata] Length = 191 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 133 RVGKQIVN 140 >gb|EME38681.1| ribosomal protein S9-like protein [Dothistroma septosporum NZE10] Length = 193 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 133 RVGKQIVN 140 >gb|EKG11582.1| Ribosomal protein S4/S9 [Macrophomina phaseolina MS6] Length = 191 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 133 RVGKQIVN 140 >ref|XP_009155008.1| 40S ribosomal protein S9 [Exophiala dermatitidis NIH/UT8656] gi|378728088|gb|EHY54547.1| 40S ribosomal protein S9 [Exophiala dermatitidis NIH/UT8656] Length = 193 Score = 133 bits (334), Expect = 5e-29 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 182 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVN 206 RVGKQIVN Sbjct: 133 RVGKQIVN 140