BLASTX nr result
ID: Forsythia21_contig00022675
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00022675 (274 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB11774.1| hypothetical protein B456_001G276600 [Gossypium r... 64 4e-08 gb|ENH98551.1| hypothetical protein COCC4DRAFT_155470 [Bipolaris... 42 2e-06 ref|XP_003744105.1| PREDICTED: uncharacterized protein LOC100900... 39 9e-06 gb|KDQ49118.1| hypothetical protein JAAARDRAFT_143849, partial [... 40 9e-06 gb|KDQ05624.1| hypothetical protein BOTBODRAFT_60888 [Botryobasi... 40 9e-06 ref|XP_007871309.1| hypothetical protein GLOTRDRAFT_50878, parti... 40 1e-05 >gb|KJB11774.1| hypothetical protein B456_001G276600 [Gossypium raimondii] gi|763744276|gb|KJB11775.1| hypothetical protein B456_001G276700 [Gossypium raimondii] gi|763744277|gb|KJB11776.1| hypothetical protein B456_001G276800 [Gossypium raimondii] Length = 124 Score = 63.9 bits (154), Expect = 4e-08 Identities = 34/64 (53%), Positives = 41/64 (64%) Frame = +1 Query: 76 QLAQGLSVNN*QPNQNWHGLRESDCLIKTKQAEGHNWC*QLVISAQCFECYLFEMTISAS 255 +L +G S + Q QNW+G ESDCLIKTK +G C + VISAQC EC E+ SA Sbjct: 61 RLPRGPSPGDEQSTQNWYGQGESDCLIKTKHCDGPCGCSRNVISAQCSECQSEEIQPSAG 120 Query: 256 KRRE 267 KRRE Sbjct: 121 KRRE 124 >gb|ENH98551.1| hypothetical protein COCC4DRAFT_155470 [Bipolaris maydis ATCC 48331] Length = 96 Score = 42.4 bits (98), Expect(2) = 2e-06 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = -1 Query: 274 IVTPAVYLRLLSSQTNNIQSTGQKSQAVNTSY 179 IVTPAVY RL+ S +IQSTGQKS VNT++ Sbjct: 45 IVTPAVYPRLVESLRFDIQSTGQKSHCVNTTF 76 Score = 36.2 bits (82), Expect(2) = 2e-06 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 179 WPSACFVLIRQSDSRSPCQF 120 WPS C+VLIRQSDS P QF Sbjct: 77 WPSQCYVLIRQSDSPCPYQF 96 >ref|XP_003744105.1| PREDICTED: uncharacterized protein LOC100900125 [Metaseiulus occidentalis] Length = 133 Score = 38.5 bits (88), Expect(2) = 9e-06 Identities = 20/32 (62%), Positives = 22/32 (68%) Frame = -1 Query: 274 IVTPAVYLRLLSSQTNNIQSTGQKSQAVNTSY 179 IVTPAVY R S +IQSTGQKS V T+Y Sbjct: 82 IVTPAVYPRFKESLHFDIQSTGQKSHCVKTNY 113 Score = 37.4 bits (85), Expect(2) = 9e-06 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 179 WPSACFVLIRQSDSRSPCQF 120 W S CFVLIRQSDS S CQF Sbjct: 114 WTSQCFVLIRQSDSLSSCQF 133 >gb|KDQ49118.1| hypothetical protein JAAARDRAFT_143849, partial [Jaapia argillacea MUCL 33604] gi|646383648|gb|KDQ49129.1| hypothetical protein JAAARDRAFT_143868, partial [Jaapia argillacea MUCL 33604] Length = 100 Score = 39.7 bits (91), Expect(2) = 9e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = -1 Query: 274 IVTPAVYLRLLSSQTNNIQSTGQKSQAVNTSY 179 IVTPAVY RL+ +IQSTGQKS VNT++ Sbjct: 49 IVTPAVYPRLVEFLHFDIQSTGQKSHCVNTTF 80 Score = 36.2 bits (82), Expect(2) = 9e-06 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 179 WPSACFVLIRQSDSRSPCQF 120 WPS C+VLIRQSDS P QF Sbjct: 81 WPSQCYVLIRQSDSPCPYQF 100 >gb|KDQ05624.1| hypothetical protein BOTBODRAFT_60888 [Botryobasidium botryosum FD-172 SS1] gi|648151319|gb|KDR65249.1| hypothetical protein GALMADRAFT_82098 [Galerina marginata CBS 339.88] Length = 96 Score = 39.7 bits (91), Expect(2) = 9e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = -1 Query: 274 IVTPAVYLRLLSSQTNNIQSTGQKSQAVNTSY 179 IVTPAVY RL+ +IQSTGQKS VNT++ Sbjct: 45 IVTPAVYPRLVEFLHFDIQSTGQKSHCVNTTF 76 Score = 36.2 bits (82), Expect(2) = 9e-06 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 179 WPSACFVLIRQSDSRSPCQF 120 WPS C+VLIRQSDS P QF Sbjct: 77 WPSQCYVLIRQSDSPCPYQF 96 >ref|XP_007871309.1| hypothetical protein GLOTRDRAFT_50878, partial [Gloeophyllum trabeum ATCC 11539] gi|449539125|gb|EMD30442.1| hypothetical protein CERSUDRAFT_163840, partial [Ceriporiopsis subvermispora B] gi|449540873|gb|EMD31861.1| hypothetical protein CERSUDRAFT_59500, partial [Ceriporiopsis subvermispora B] gi|521719763|gb|EPQ50235.1| hypothetical protein GLOTRDRAFT_50878, partial [Gloeophyllum trabeum ATCC 11539] Length = 64 Score = 39.7 bits (91), Expect(2) = 1e-05 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = -1 Query: 274 IVTPAVYLRLLSSQTNNIQSTGQKSQAVNTSY 179 IVTPAVY RL+ +IQSTGQKS VNT++ Sbjct: 13 IVTPAVYPRLVEFLHFDIQSTGQKSHCVNTTF 44 Score = 36.2 bits (82), Expect(2) = 1e-05 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 179 WPSACFVLIRQSDSRSPCQF 120 WPS C+VLIRQSDS P QF Sbjct: 45 WPSQCYVLIRQSDSPCPYQF 64