BLASTX nr result
ID: Forsythia21_contig00022294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00022294 (374 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ63888.1| 60S ribosomal protein-like protein L39 [Aureobasi... 83 8e-14 dbj|GAO13893.1| hypothetical protein UVI_009110 [Ustilaginoidea ... 81 2e-13 ref|XP_003844630.1| similar to 60S ribosomal protein L39 [Leptos... 81 3e-13 ref|XP_001799583.1| hypothetical protein SNOG_09286 [Phaeosphaer... 81 3e-13 ref|XP_008717114.1| 60S ribosomal protein L39 [Cyphellophora eur... 80 4e-13 gb|EMF12058.1| ribosomal protein L39e [Sphaerulina musiva SO2202] 80 4e-13 ref|XP_007926934.1| hypothetical protein MYCFIDRAFT_30141, parti... 80 4e-13 gb|EME43136.1| hypothetical protein DOTSEDRAFT_173805 [Dothistro... 80 4e-13 ref|XP_003850033.1| 60S ribosomal protein L39 [Zymoseptoria trit... 80 4e-13 emb|CEF83650.1| unnamed protein product [Fusarium graminearum] 80 5e-13 emb|CCT65955.1| probable RPL39-60S large subunit ribosomal prote... 80 5e-13 gb|EMT65472.1| 60S ribosomal protein L39, partial [Fusarium oxys... 80 5e-13 ref|XP_003051759.1| 60S ribosomal protein L39 [Nectria haematoco... 80 5e-13 emb|CEJ54809.1| Putative 60s ribosomal protein l39 [Penicillium ... 80 7e-13 gb|KJR85651.1| large subunit ribosomal protein L39e [Sporothrix ... 80 7e-13 gb|KFX44402.1| 60S ribosomal protein L39, partial [Talaromyces m... 80 7e-13 ref|XP_002482271.1| ribosomal protein L39e, putative [Talaromyce... 80 7e-13 emb|CCX04754.1| Protein of unknown function [Pyronema omphalodes... 80 7e-13 gb|EQB47836.1| hypothetical protein CGLO_12990 [Colletotrichum g... 80 7e-13 gb|EPS27305.1| hypothetical protein PDE_02248 [Penicillium oxali... 80 7e-13 >gb|KEQ63888.1| 60S ribosomal protein-like protein L39 [Aureobasidium melanogenum CBS 110374] gi|662517991|gb|KEQ75552.1| 60S ribosomal protein-like protein L39 [Aureobasidium namibiae CBS 147.97] gi|662523116|gb|KEQ80511.1| 60S ribosomal protein-like protein L39 [Aureobasidium pullulans EXF-150] gi|662538824|gb|KEQ96129.1| hypothetical protein AUEXF2481DRAFT_4380 [Aureobasidium subglaciale EXF-2481] Length = 51 Score = 82.8 bits (203), Expect = 8e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI Sbjct: 15 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 51 >dbj|GAO13893.1| hypothetical protein UVI_009110 [Ustilaginoidea virens] Length = 51 Score = 81.3 bits (199), Expect = 2e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 KAQKQNRP+PQWIRLRTNNT+RYNAKRRHWRKTR+GI Sbjct: 15 KAQKQNRPVPQWIRLRTNNTVRYNAKRRHWRKTRLGI 51 >ref|XP_003844630.1| similar to 60S ribosomal protein L39 [Leptosphaeria maculans JN3] gi|312221210|emb|CBY01151.1| similar to 60S ribosomal protein L39 [Leptosphaeria maculans JN3] Length = 51 Score = 80.9 bits (198), Expect = 3e-13 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 +AQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTR+GI Sbjct: 15 RAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRLGI 51 >ref|XP_001799583.1| hypothetical protein SNOG_09286 [Phaeosphaeria nodorum SN15] gi|160702486|gb|EAT83478.2| hypothetical protein SNOG_09286 [Phaeosphaeria nodorum SN15] Length = 95 Score = 80.9 bits (198), Expect = 3e-13 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 +AQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTR+GI Sbjct: 59 RAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRLGI 95 >ref|XP_008717114.1| 60S ribosomal protein L39 [Cyphellophora europaea CBS 101466] gi|568117655|gb|ETN40271.1| 60S ribosomal protein L39 [Cyphellophora europaea CBS 101466] Length = 72 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 KAQKQNRPIPQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 36 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 72 >gb|EMF12058.1| ribosomal protein L39e [Sphaerulina musiva SO2202] Length = 51 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 KAQKQNRPIPQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 15 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >ref|XP_007926934.1| hypothetical protein MYCFIDRAFT_30141, partial [Pseudocercospora fijiensis CIRAD86] gi|452982335|gb|EME82094.1| hypothetical protein MYCFIDRAFT_30141, partial [Pseudocercospora fijiensis CIRAD86] Length = 49 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 KAQKQNRPIPQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 13 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 49 >gb|EME43136.1| hypothetical protein DOTSEDRAFT_173805 [Dothistroma septosporum NZE10] Length = 51 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 KAQKQNRPIPQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 15 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >ref|XP_003850033.1| 60S ribosomal protein L39 [Zymoseptoria tritici IPO323] gi|667834302|ref|XP_007781320.1| 60S ribosomal protein L39 [Coniosporium apollinis CBS 100218] gi|339469911|gb|EGP85009.1| hypothetical protein MYCGRDRAFT_105463 [Zymoseptoria tritici IPO323] gi|494829312|gb|EON66003.1| 60S ribosomal protein L39 [Coniosporium apollinis CBS 100218] gi|751758072|gb|KIN06246.1| hypothetical protein OIDMADRAFT_38580 [Oidiodendron maius Zn] gi|752278391|dbj|GAM86723.1| hypothetical protein ANO11243_047420 [fungal sp. No.11243] gi|796708356|gb|KJX99510.1| 60S ribosomal protein L39 [Zymoseptoria brevis] Length = 51 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 KAQKQNRPIPQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 15 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >emb|CEF83650.1| unnamed protein product [Fusarium graminearum] Length = 68 Score = 80.1 bits (196), Expect = 5e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 KAQKQNRP+PQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 32 KAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 68 >emb|CCT65955.1| probable RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi IMI 58289] Length = 93 Score = 80.1 bits (196), Expect = 5e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 KAQKQNRP+PQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 57 KAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 93 >gb|EMT65472.1| 60S ribosomal protein L39, partial [Fusarium oxysporum f. sp. cubense race 4] gi|477512034|gb|ENH64595.1| 60S ribosomal protein L39, partial [Fusarium oxysporum f. sp. cubense race 1] Length = 49 Score = 80.1 bits (196), Expect = 5e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 KAQKQNRP+PQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 13 KAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 49 >ref|XP_003051759.1| 60S ribosomal protein L39 [Nectria haematococca mpVI 77-13-4] gi|685872197|ref|XP_009263131.1| hypothetical protein FPSE_11739 [Fusarium pseudograminearum CS3096] gi|758208834|ref|XP_011326588.1| hypothetical protein FGSG_06921 [Fusarium graminearum PH-1] gi|256732698|gb|EEU46046.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|342865967|gb|EGU71968.1| hypothetical protein FOXB_17529 [Fusarium oxysporum Fo5176] gi|408388242|gb|EKJ67928.1| hypothetical protein FPSE_11739 [Fusarium pseudograminearum CS3096] gi|558862998|gb|ESU13081.1| hypothetical protein FGSG_06921 [Fusarium graminearum PH-1] gi|584139211|gb|EWG48551.1| 60S ribosomal protein L39 [Fusarium verticillioides 7600] gi|587676271|gb|EWY98599.1| 60S ribosomal protein L39 [Fusarium oxysporum FOSC 3-a] gi|587698070|gb|EWZ44675.1| 60S ribosomal protein L39 [Fusarium oxysporum Fo47] gi|587727111|gb|EWZ98448.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587752242|gb|EXA49958.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. pisi HDV247] gi|590040183|gb|EXK42041.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. melonis 26406] gi|590073088|gb|EXL00613.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. raphani 54005] gi|591426865|gb|EXL62002.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591453858|gb|EXL86129.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591463667|gb|EXL95148.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591507348|gb|EXM36611.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. vasinfectum 25433] gi|596543402|gb|EYB23707.1| hypothetical protein FG05_06921 [Fusarium graminearum] gi|829113621|gb|KLO90055.1| putative RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi] gi|829136452|gb|KLP09859.1| putative RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi] gi|829151008|gb|KLP19369.1| putative RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi] Length = 51 Score = 80.1 bits (196), Expect = 5e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 KAQKQNRP+PQWIRLRT NTIRYNAKRRHWRKTRIGI Sbjct: 15 KAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >emb|CEJ54809.1| Putative 60s ribosomal protein l39 [Penicillium brasilianum] Length = 92 Score = 79.7 bits (195), Expect = 7e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 KAQKQNRPIPQWIRLRT NTIRYNAKRRHWRKTR+GI Sbjct: 56 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 92 >gb|KJR85651.1| large subunit ribosomal protein L39e [Sporothrix schenckii 1099-18] Length = 51 Score = 79.7 bits (195), Expect = 7e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 KAQKQNRPIPQWIRLRT NTIRYNAKRRHWRKTR+GI Sbjct: 15 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >gb|KFX44402.1| 60S ribosomal protein L39, partial [Talaromyces marneffei PM1] Length = 64 Score = 79.7 bits (195), Expect = 7e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 KAQKQNRPIPQWIRLRT NTIRYNAKRRHWRKTR+GI Sbjct: 28 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 64 >ref|XP_002482271.1| ribosomal protein L39e, putative [Talaromyces stipitatus ATCC 10500] gi|218718859|gb|EED18279.1| ribosomal protein L39e, putative [Talaromyces stipitatus ATCC 10500] Length = 109 Score = 79.7 bits (195), Expect = 7e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 KAQKQNRPIPQWIRLRT NTIRYNAKRRHWRKTR+GI Sbjct: 73 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 109 >emb|CCX04754.1| Protein of unknown function [Pyronema omphalodes CBS 100304] Length = 51 Score = 79.7 bits (195), Expect = 7e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 KAQKQNRPIPQWIRLRT NTIRYNAKRRHWRKTR+GI Sbjct: 15 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >gb|EQB47836.1| hypothetical protein CGLO_12990 [Colletotrichum gloeosporioides Cg-14] Length = 97 Score = 79.7 bits (195), Expect = 7e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 KAQKQNRPIPQWIRLRT NTIRYNAKRRHWRKTR+GI Sbjct: 61 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 97 >gb|EPS27305.1| hypothetical protein PDE_02248 [Penicillium oxalicum 114-2] Length = 51 Score = 79.7 bits (195), Expect = 7e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 372 KAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRIGI 262 KAQKQNRPIPQWIRLRT NTIRYNAKRRHWRKTR+GI Sbjct: 15 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51