BLASTX nr result
ID: Forsythia21_contig00022182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00022182 (541 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010063772.1| PREDICTED: transmembrane protein 18 [Eucalyp... 76 8e-12 ref|XP_010094861.1| hypothetical protein L484_016443 [Morus nota... 75 2e-11 ref|XP_010256327.1| PREDICTED: transmembrane protein 18 [Nelumbo... 75 2e-11 ref|XP_012446377.1| PREDICTED: transmembrane protein 18 [Gossypi... 73 9e-11 ref|XP_011074919.1| PREDICTED: transmembrane protein 18 [Sesamum... 73 9e-11 gb|KHG08404.1| tmem18 [Gossypium arboreum] 73 9e-11 ref|XP_002526846.1| conserved hypothetical protein [Ricinus comm... 73 9e-11 gb|AFK35494.1| unknown [Lotus japonicus] gi|388496944|gb|AFK3653... 72 1e-10 ref|NP_001237116.1| uncharacterized protein LOC100527513 [Glycin... 72 1e-10 emb|CDX73307.1| BnaC05g27990D [Brassica napus] 72 2e-10 ref|XP_002263968.1| PREDICTED: transmembrane protein 18 [Vitis v... 71 2e-10 ref|NP_001238601.1| uncharacterized protein LOC100305910 [Glycin... 71 3e-10 gb|KMS99960.1| hypothetical protein BVRB_1g018030 isoform B [Bet... 70 4e-10 ref|XP_011038158.1| PREDICTED: transmembrane protein 18 [Populus... 70 4e-10 ref|XP_010692085.1| PREDICTED: transmembrane protein 18-like [Be... 70 4e-10 ref|XP_010530145.1| PREDICTED: transmembrane protein 18-like [Ta... 70 4e-10 ref|XP_009772564.1| PREDICTED: transmembrane protein 18 [Nicotia... 70 4e-10 ref|XP_009606399.1| PREDICTED: transmembrane protein 18 [Nicotia... 70 4e-10 emb|CDP18329.1| unnamed protein product [Coffea canephora] 70 4e-10 ref|XP_012853533.1| PREDICTED: transmembrane protein 18 [Erythra... 70 4e-10 >ref|XP_010063772.1| PREDICTED: transmembrane protein 18 [Eucalyptus grandis] gi|629105567|gb|KCW71036.1| hypothetical protein EUGRSUZ_F04136 [Eucalyptus grandis] Length = 163 Score = 76.3 bits (186), Expect = 8e-12 Identities = 37/54 (68%), Positives = 42/54 (77%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWKXXXXXXXXXXXRSKED 380 DP+G+FLS LWSGPLLVIAI+ILVNTLLSLCHLIVRWK R+K+D Sbjct: 110 DPQGIFLSTLWSGPLLVIAIVILVNTLLSLCHLIVRWKKAELRHRARLSRNKQD 163 >ref|XP_010094861.1| hypothetical protein L484_016443 [Morus notabilis] gi|587868017|gb|EXB57390.1| hypothetical protein L484_016443 [Morus notabilis] Length = 202 Score = 74.7 bits (182), Expect = 2e-11 Identities = 37/54 (68%), Positives = 40/54 (74%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWKXXXXXXXXXXXRSKED 380 DP GLFLSVLWSGPLL IAIIIL+NTL SLCHLIVRWK R+K+D Sbjct: 149 DPNGLFLSVLWSGPLLFIAIIILINTLFSLCHLIVRWKKAELRHRARLARNKQD 202 >ref|XP_010256327.1| PREDICTED: transmembrane protein 18 [Nelumbo nucifera] Length = 163 Score = 74.7 bits (182), Expect = 2e-11 Identities = 36/54 (66%), Positives = 41/54 (75%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWKXXXXXXXXXXXRSKED 380 DP GLFLSVLWSGPLL+IAIIIL++TL SLCHLIVRWK +SK+D Sbjct: 110 DPHGLFLSVLWSGPLLIIAIIILMSTLFSLCHLIVRWKKAELRHRARLSQSKQD 163 >ref|XP_012446377.1| PREDICTED: transmembrane protein 18 [Gossypium raimondii] gi|763792617|gb|KJB59613.1| hypothetical protein B456_009G263900 [Gossypium raimondii] Length = 163 Score = 72.8 bits (177), Expect = 9e-11 Identities = 35/54 (64%), Positives = 41/54 (75%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWKXXXXXXXXXXXRSKED 380 DP GLFLSVLWSGPLL+IAIIIL+NTL S+C+LIVRWK R+K+D Sbjct: 110 DPSGLFLSVLWSGPLLIIAIIILINTLFSMCYLIVRWKKAELRHRARLARNKQD 163 >ref|XP_011074919.1| PREDICTED: transmembrane protein 18 [Sesamum indicum] Length = 163 Score = 72.8 bits (177), Expect = 9e-11 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWK 428 D GLFLSVLWSGPLLVIAIIILVNTL SLCHLIVRWK Sbjct: 110 DRNGLFLSVLWSGPLLVIAIIILVNTLFSLCHLIVRWK 147 >gb|KHG08404.1| tmem18 [Gossypium arboreum] Length = 163 Score = 72.8 bits (177), Expect = 9e-11 Identities = 35/54 (64%), Positives = 41/54 (75%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWKXXXXXXXXXXXRSKED 380 DP GLFLSVLWSGPLL+IAIIIL+NTL S+C+LIVRWK R+K+D Sbjct: 110 DPSGLFLSVLWSGPLLIIAIIILINTLFSMCYLIVRWKKAELRHRARLARNKQD 163 >ref|XP_002526846.1| conserved hypothetical protein [Ricinus communis] gi|223533850|gb|EEF35581.1| conserved hypothetical protein [Ricinus communis] Length = 163 Score = 72.8 bits (177), Expect = 9e-11 Identities = 34/54 (62%), Positives = 40/54 (74%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWKXXXXXXXXXXXRSKED 380 DP+GLFLS LWSGPLL+IAIIIL+NTL SLC+LIVRWK +K+D Sbjct: 110 DPQGLFLSALWSGPLLIIAIIILINTLFSLCYLIVRWKRAELRHRARLSHNKQD 163 >gb|AFK35494.1| unknown [Lotus japonicus] gi|388496944|gb|AFK36538.1| unknown [Lotus japonicus] Length = 163 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWKXXXXXXXXXXXRSKED 380 DP GLF+SVLWSGPLLVIA+IILVNTL SLC+LIV+WK SK+D Sbjct: 110 DPSGLFMSVLWSGPLLVIAMIILVNTLFSLCYLIVKWKRAELRHRARAASSKQD 163 >ref|NP_001237116.1| uncharacterized protein LOC100527513 [Glycine max] gi|255632518|gb|ACU16609.1| unknown [Glycine max] gi|734404025|gb|KHN32796.1| Transmembrane protein 18 [Glycine soja] Length = 163 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/54 (62%), Positives = 42/54 (77%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWKXXXXXXXXXXXRSKED 380 DPRGLF+SVLWSGPLLVI++IIL+NTL SLC++IVRWK R+K+D Sbjct: 110 DPRGLFMSVLWSGPLLVISMIILINTLFSLCYMIVRWKRAELRHRARAARNKQD 163 >emb|CDX73307.1| BnaC05g27990D [Brassica napus] Length = 163 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/54 (64%), Positives = 42/54 (77%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWKXXXXXXXXXXXRSKED 380 DP+G FLSVLWSGPLLVIA+IIL+NTLLSLC+LIV+WK RSK++ Sbjct: 110 DPQGAFLSVLWSGPLLVIAMIILINTLLSLCYLIVKWKRAELRHRARVARSKQE 163 >ref|XP_002263968.1| PREDICTED: transmembrane protein 18 [Vitis vinifera] gi|297739539|emb|CBI29721.3| unnamed protein product [Vitis vinifera] Length = 163 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/54 (62%), Positives = 41/54 (75%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWKXXXXXXXXXXXRSKED 380 DPRGLFLSVLWSGPLL+IAIIIL+NTL SLC L+++WK R+K+D Sbjct: 110 DPRGLFLSVLWSGPLLLIAIIILLNTLFSLCRLLIKWKRAELRHRALLARNKQD 163 >ref|NP_001238601.1| uncharacterized protein LOC100305910 [Glycine max] gi|571475418|ref|XP_006586617.1| PREDICTED: uncharacterized protein LOC100305910 isoform X1 [Glycine max] gi|255626951|gb|ACU13820.1| unknown [Glycine max] gi|734382324|gb|KHN23599.1| Transmembrane protein 18 [Glycine soja] Length = 163 Score = 70.9 bits (172), Expect = 3e-10 Identities = 34/54 (62%), Positives = 41/54 (75%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWKXXXXXXXXXXXRSKED 380 DP GLF+SVLWSGPLLVI++IIL+NTL SLC+LIVRWK R+K+D Sbjct: 110 DPSGLFMSVLWSGPLLVISMIILINTLFSLCYLIVRWKRAELRHRARAARNKQD 163 >gb|KMS99960.1| hypothetical protein BVRB_1g018030 isoform B [Beta vulgaris subsp. vulgaris] Length = 112 Score = 70.5 bits (171), Expect = 4e-10 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWK 428 DP G+FLSVLWSGPLL+IAI+IL+NTL S+CHLI++WK Sbjct: 59 DPHGIFLSVLWSGPLLLIAILILINTLFSMCHLIIQWK 96 >ref|XP_011038158.1| PREDICTED: transmembrane protein 18 [Populus euphratica] Length = 165 Score = 70.5 bits (171), Expect = 4e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWK 428 DP GLFLSVLWSGPLL+IA IIL+NTL SLC++IVRWK Sbjct: 110 DPHGLFLSVLWSGPLLIIATIILINTLFSLCYMIVRWK 147 >ref|XP_010692085.1| PREDICTED: transmembrane protein 18-like [Beta vulgaris subsp. vulgaris] gi|870847612|gb|KMS99959.1| hypothetical protein BVRB_1g018030 isoform A [Beta vulgaris subsp. vulgaris] Length = 163 Score = 70.5 bits (171), Expect = 4e-10 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWK 428 DP G+FLSVLWSGPLL+IAI+IL+NTL S+CHLI++WK Sbjct: 110 DPHGIFLSVLWSGPLLLIAILILINTLFSMCHLIIQWK 147 >ref|XP_010530145.1| PREDICTED: transmembrane protein 18-like [Tarenaya hassleriana] Length = 203 Score = 70.5 bits (171), Expect = 4e-10 Identities = 34/54 (62%), Positives = 39/54 (72%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWKXXXXXXXXXXXRSKED 380 DP G FLSV WSGPLLVIA+IIL+NTL SLCHLIV+WK RSK++ Sbjct: 150 DPHGAFLSVFWSGPLLVIAMIILINTLFSLCHLIVKWKRAELRHRARLARSKQE 203 >ref|XP_009772564.1| PREDICTED: transmembrane protein 18 [Nicotiana sylvestris] Length = 163 Score = 70.5 bits (171), Expect = 4e-10 Identities = 36/54 (66%), Positives = 39/54 (72%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWKXXXXXXXXXXXRSKED 380 D G+FLS LWSGPLLVIAIIILVNTL SLC+LIVRWK R+KED Sbjct: 110 DSHGIFLSTLWSGPLLVIAIIILVNTLFSLCYLIVRWKKAELRHRARLARNKED 163 >ref|XP_009606399.1| PREDICTED: transmembrane protein 18 [Nicotiana tomentosiformis] Length = 163 Score = 70.5 bits (171), Expect = 4e-10 Identities = 36/54 (66%), Positives = 39/54 (72%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWKXXXXXXXXXXXRSKED 380 D G+FLS LWSGPLLVIAIIILVNTL SLC+LIVRWK R+KED Sbjct: 110 DSHGIFLSTLWSGPLLVIAIIILVNTLFSLCYLIVRWKKAELRHRARLARNKED 163 >emb|CDP18329.1| unnamed protein product [Coffea canephora] Length = 163 Score = 70.5 bits (171), Expect = 4e-10 Identities = 34/54 (62%), Positives = 40/54 (74%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWKXXXXXXXXXXXRSKED 380 D GLFLSVLWSGPLLV+AI++LVNTL SLC+LIVRWK R+K+D Sbjct: 110 DSHGLFLSVLWSGPLLVVAIVVLVNTLFSLCYLIVRWKKAELRHRAREARNKQD 163 >ref|XP_012853533.1| PREDICTED: transmembrane protein 18 [Erythranthe guttatus] gi|604304693|gb|EYU23944.1| hypothetical protein MIMGU_mgv1a015262mg [Erythranthe guttata] Length = 163 Score = 70.5 bits (171), Expect = 4e-10 Identities = 35/54 (64%), Positives = 39/54 (72%) Frame = -1 Query: 541 DPRGLFLSVLWSGPLLVIAIIILVNTLLSLCHLIVRWKXXXXXXXXXXXRSKED 380 D G+FLS+LWSGPLLVIAIIILVNTL S+CHL+VRWK RSK D Sbjct: 110 DSHGIFLSILWSGPLLVIAIIILVNTLFSMCHLMVRWKKAELKHRARVARSKVD 163