BLASTX nr result
ID: Forsythia21_contig00019823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00019823 (329 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015431.1| NAC domain containing protein 25, putative [... 91 2e-16 gb|EYU18855.1| hypothetical protein MIMGU_mgv1a018754mg, partial... 89 9e-16 ref|XP_004487133.1| PREDICTED: NAC transcription factor NAM-B2-l... 89 1e-15 emb|CDP07132.1| unnamed protein product [Coffea canephora] 89 2e-15 ref|XP_003597198.1| NAC domain-containing protein [Medicago trun... 88 2e-15 gb|KDO73209.1| hypothetical protein CISIN_1g045934mg [Citrus sin... 88 3e-15 gb|KCW85722.1| hypothetical protein EUGRSUZ_B02485 [Eucalyptus g... 88 3e-15 ref|XP_006488646.1| PREDICTED: NAC domain-containing protein 18-... 88 3e-15 ref|XP_006424612.1| hypothetical protein CICLE_v10030252mg [Citr... 88 3e-15 emb|CDP07135.1| unnamed protein product [Coffea canephora] 87 3e-15 ref|XP_002519550.1| transcription factor, putative [Ricinus comm... 87 3e-15 ref|XP_007027296.1| NAC domain protein, IPR003441, putative [The... 87 3e-15 ref|XP_010651145.1| PREDICTED: NAC transcription factor 25-like ... 87 6e-15 emb|CBI16292.3| unnamed protein product [Vitis vinifera] 87 6e-15 ref|XP_007150216.1| hypothetical protein PHAVU_005G136400g [Phas... 87 6e-15 ref|XP_006381471.1| hypothetical protein POPTR_0006s13140g, part... 87 6e-15 ref|XP_003541998.1| PREDICTED: NAC transcription factor ONAC010-... 87 6e-15 ref|XP_012065118.1| PREDICTED: NAC domain-containing protein 68-... 86 7e-15 ref|XP_010032014.1| PREDICTED: NAC domain-containing protein 68-... 86 1e-14 gb|KCW51403.1| hypothetical protein EUGRSUZ_J00940, partial [Euc... 86 1e-14 >ref|XP_007015431.1| NAC domain containing protein 25, putative [Theobroma cacao] gi|508785794|gb|EOY33050.1| NAC domain containing protein 25, putative [Theobroma cacao] Length = 399 Score = 91.3 bits (225), Expect = 2e-16 Identities = 41/66 (62%), Positives = 52/66 (78%) Frame = -1 Query: 203 AVSMEKNFIFSASFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELA 24 ++SME+ + FPPG RFHPSDEELI++YL NKV S PLPA+VIA+ LY Y+PWEL Sbjct: 49 SISMEREPNLNFHFPPGFRFHPSDEELIIHYLQNKVTSRPLPASVIAEIDLYKYNPWELP 108 Query: 23 RKAVFG 6 +KA+FG Sbjct: 109 KKALFG 114 >gb|EYU18855.1| hypothetical protein MIMGU_mgv1a018754mg, partial [Erythranthe guttata] Length = 201 Score = 89.4 bits (220), Expect = 9e-16 Identities = 41/62 (66%), Positives = 45/62 (72%) Frame = -1 Query: 194 MEKNFIFSASFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELARKA 15 MEKN +PPGIRFHPSDEELI YYL KV LPLP NVI D LY Y+PW+L RKA Sbjct: 1 MEKNRFSDVEYPPGIRFHPSDEELISYYLHRKVNYLPLPPNVITDIHLYSYNPWDLPRKA 60 Query: 14 VF 9 +F Sbjct: 61 LF 62 >ref|XP_004487133.1| PREDICTED: NAC transcription factor NAM-B2-like [Cicer arietinum] Length = 339 Score = 89.0 bits (219), Expect = 1e-15 Identities = 38/56 (67%), Positives = 48/56 (85%) Frame = -1 Query: 173 SASFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELARKAVFG 6 S +FPPG RFHPSDEELIV+YL K+KSLPLPA++IA+ LY Y+PWEL +K++FG Sbjct: 9 SYTFPPGFRFHPSDEELIVHYLQKKIKSLPLPASIIAEIDLYKYNPWELPKKSLFG 64 >emb|CDP07132.1| unnamed protein product [Coffea canephora] Length = 345 Score = 88.6 bits (218), Expect = 2e-15 Identities = 40/63 (63%), Positives = 49/63 (77%) Frame = -1 Query: 194 MEKNFIFSASFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELARKA 15 ME I S FPPG+RF+PSDEELIVYYL NKV S PLPA V+ + +LY Y+PW+L +KA Sbjct: 1 METQPISSFQFPPGVRFYPSDEELIVYYLHNKVNSRPLPAAVVGEIELYSYNPWDLPKKA 60 Query: 14 VFG 6 +FG Sbjct: 61 LFG 63 >ref|XP_003597198.1| NAC domain-containing protein [Medicago truncatula] gi|87241197|gb|ABD33055.1| No apical meristem (NAM) protein [Medicago truncatula] gi|355486246|gb|AES67449.1| NAC transcription factor-like protein [Medicago truncatula] Length = 323 Score = 88.2 bits (217), Expect = 2e-15 Identities = 37/54 (68%), Positives = 47/54 (87%) Frame = -1 Query: 167 SFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELARKAVFG 6 +FPPG RFHPSDEELIV+YL NK+KS PLPA++IA+ LY Y+PWEL +K++FG Sbjct: 13 TFPPGFRFHPSDEELIVHYLQNKIKSRPLPASIIAEIDLYKYNPWELPKKSLFG 66 >gb|KDO73209.1| hypothetical protein CISIN_1g045934mg [Citrus sinensis] Length = 350 Score = 87.8 bits (216), Expect = 3e-15 Identities = 40/62 (64%), Positives = 48/62 (77%) Frame = -1 Query: 191 EKNFIFSASFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELARKAV 12 E N S FPPG RFHPSD+ELIVYYL NKV S PLPA++IA+ LY Y+PWEL ++A+ Sbjct: 4 EHNPAASFQFPPGFRFHPSDQELIVYYLQNKVTSRPLPASLIAEVDLYKYNPWELPKQAL 63 Query: 11 FG 6 FG Sbjct: 64 FG 65 >gb|KCW85722.1| hypothetical protein EUGRSUZ_B02485 [Eucalyptus grandis] Length = 279 Score = 87.8 bits (216), Expect = 3e-15 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 1/64 (1%) Frame = -1 Query: 194 MEKNFIFSASFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWEL-ARK 18 MEK + FPPG RFHPSDEELI++YL NKV SLPLPA VIAD LY Y+PWEL K Sbjct: 1 MEKESSSTFQFPPGFRFHPSDEELIIHYLQNKVTSLPLPAPVIADIDLYKYNPWELPTEK 60 Query: 17 AVFG 6 A+FG Sbjct: 61 ALFG 64 >ref|XP_006488646.1| PREDICTED: NAC domain-containing protein 18-like [Citrus sinensis] Length = 350 Score = 87.8 bits (216), Expect = 3e-15 Identities = 40/62 (64%), Positives = 48/62 (77%) Frame = -1 Query: 191 EKNFIFSASFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELARKAV 12 E N S FPPG RFHPSD+ELIVYYL NKV S PLPA++IA+ LY Y+PWEL ++A+ Sbjct: 4 EHNPAASFQFPPGFRFHPSDQELIVYYLQNKVTSRPLPASLIAEVDLYKYNPWELPKQAL 63 Query: 11 FG 6 FG Sbjct: 64 FG 65 >ref|XP_006424612.1| hypothetical protein CICLE_v10030252mg [Citrus clementina] gi|557526546|gb|ESR37852.1| hypothetical protein CICLE_v10030252mg [Citrus clementina] Length = 350 Score = 87.8 bits (216), Expect = 3e-15 Identities = 40/62 (64%), Positives = 48/62 (77%) Frame = -1 Query: 191 EKNFIFSASFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELARKAV 12 E N S FPPG RFHPSD+ELIVYYL NKV S PLPA++IA+ LY Y+PWEL ++A+ Sbjct: 4 EHNPAASFQFPPGFRFHPSDQELIVYYLQNKVTSRPLPASLIAEVDLYKYNPWELPKQAL 63 Query: 11 FG 6 FG Sbjct: 64 FG 65 >emb|CDP07135.1| unnamed protein product [Coffea canephora] Length = 309 Score = 87.4 bits (215), Expect = 3e-15 Identities = 39/63 (61%), Positives = 49/63 (77%) Frame = -1 Query: 194 MEKNFIFSASFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELARKA 15 ME I S FPPG+RFHPSDEELIV+YL NKV S PLPA V+ + +LY ++PW+L +KA Sbjct: 1 METQPISSFQFPPGVRFHPSDEELIVFYLHNKVNSRPLPAAVVGEIELYSHNPWDLPKKA 60 Query: 14 VFG 6 +FG Sbjct: 61 LFG 63 >ref|XP_002519550.1| transcription factor, putative [Ricinus communis] gi|223541413|gb|EEF42964.1| transcription factor, putative [Ricinus communis] Length = 308 Score = 87.4 bits (215), Expect = 3e-15 Identities = 41/63 (65%), Positives = 45/63 (71%) Frame = -1 Query: 194 MEKNFIFSASFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELARKA 15 ME PPG RFHPSDEELIVYYL NKV S PLPA+V+AD LY Y+PWEL +KA Sbjct: 1 METKTTSDIHLPPGFRFHPSDEELIVYYLKNKVTSNPLPASVVADLDLYKYNPWELPKKA 60 Query: 14 VFG 6 FG Sbjct: 61 SFG 63 >ref|XP_007027296.1| NAC domain protein, IPR003441, putative [Theobroma cacao] gi|508715901|gb|EOY07798.1| NAC domain protein, IPR003441, putative [Theobroma cacao] Length = 362 Score = 87.4 bits (215), Expect = 3e-15 Identities = 42/66 (63%), Positives = 48/66 (72%) Frame = -1 Query: 203 AVSMEKNFIFSASFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELA 24 A SMEK PPG RFHPSDEELIV+YL NKV S PLPA++IA+ LY Y+PWEL Sbjct: 10 ASSMEKTPGSEIQLPPGFRFHPSDEELIVHYLKNKVTSSPLPASIIAEIDLYKYNPWELP 69 Query: 23 RKAVFG 6 KA+FG Sbjct: 70 SKALFG 75 >ref|XP_010651145.1| PREDICTED: NAC transcription factor 25-like [Vitis vinifera] Length = 178 Score = 86.7 bits (213), Expect = 6e-15 Identities = 41/63 (65%), Positives = 48/63 (76%) Frame = -1 Query: 194 MEKNFIFSASFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELARKA 15 ME+ S FPPG RFHPSDEELIV+YL KV S PLPA+VIA+ LY Y+PWEL +KA Sbjct: 1 MEREPNSSFQFPPGFRFHPSDEELIVHYLQKKVTSHPLPASVIAEIDLYKYNPWELPKKA 60 Query: 14 VFG 6 +FG Sbjct: 61 LFG 63 >emb|CBI16292.3| unnamed protein product [Vitis vinifera] Length = 376 Score = 86.7 bits (213), Expect = 6e-15 Identities = 41/63 (65%), Positives = 48/63 (76%) Frame = -1 Query: 194 MEKNFIFSASFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELARKA 15 ME+ S FPPG RFHPSDEELIV+YL KV S PLPA+VIA+ LY Y+PWEL +KA Sbjct: 1 MEREPNSSFQFPPGFRFHPSDEELIVHYLQKKVTSHPLPASVIAEIDLYKYNPWELPKKA 60 Query: 14 VFG 6 +FG Sbjct: 61 LFG 63 >ref|XP_007150216.1| hypothetical protein PHAVU_005G136400g [Phaseolus vulgaris] gi|561023480|gb|ESW22210.1| hypothetical protein PHAVU_005G136400g [Phaseolus vulgaris] Length = 347 Score = 86.7 bits (213), Expect = 6e-15 Identities = 37/54 (68%), Positives = 45/54 (83%) Frame = -1 Query: 167 SFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELARKAVFG 6 SFPPG RFHPSDEELIV+YL NK+ S PLPA++IA+ LY Y+PWEL K++FG Sbjct: 11 SFPPGFRFHPSDEELIVHYLQNKISSRPLPASIIAEIDLYKYNPWELPNKSLFG 64 >ref|XP_006381471.1| hypothetical protein POPTR_0006s13140g, partial [Populus trichocarpa] gi|550336174|gb|ERP59268.1| hypothetical protein POPTR_0006s13140g, partial [Populus trichocarpa] Length = 241 Score = 86.7 bits (213), Expect = 6e-15 Identities = 39/65 (60%), Positives = 48/65 (73%) Frame = -1 Query: 197 SMEKNFIFSASFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELARK 18 +ME PPG RFHPSDEELIV+YL N+V S PLPA++IA+ LY Y+PWEL +K Sbjct: 18 NMEAKASSGIQLPPGFRFHPSDEELIVHYLKNRVSSSPLPASIIAEIDLYKYNPWELPKK 77 Query: 17 AVFGV 3 A+FGV Sbjct: 78 ALFGV 82 >ref|XP_003541998.1| PREDICTED: NAC transcription factor ONAC010-like [Glycine max] gi|734376967|gb|KHN21530.1| NAC domain-containing protein 29 [Glycine soja] Length = 349 Score = 86.7 bits (213), Expect = 6e-15 Identities = 37/54 (68%), Positives = 45/54 (83%) Frame = -1 Query: 167 SFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELARKAVFG 6 SFPPG RFHPSDEELIV+YL NK+ S PLPA++IA+ LY Y+PWEL K++FG Sbjct: 11 SFPPGFRFHPSDEELIVHYLQNKISSRPLPASIIAEINLYKYNPWELPNKSLFG 64 >ref|XP_012065118.1| PREDICTED: NAC domain-containing protein 68-like [Jatropha curcas] gi|495025517|gb|AGL39679.1| NAC transcription factor 023 [Jatropha curcas] Length = 350 Score = 86.3 bits (212), Expect = 7e-15 Identities = 37/63 (58%), Positives = 49/63 (77%) Frame = -1 Query: 194 MEKNFIFSASFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELARKA 15 ME+ + FPPG RFHPSDEELI++YL+NKV S PLPA++IA+ LY +PWEL +KA Sbjct: 1 MEREHSSNFKFPPGFRFHPSDEELIIHYLINKVSSRPLPASIIAEIDLYKCNPWELPKKA 60 Query: 14 VFG 6 ++G Sbjct: 61 LYG 63 >ref|XP_010032014.1| PREDICTED: NAC domain-containing protein 68-like [Eucalyptus grandis] Length = 340 Score = 85.9 bits (211), Expect = 1e-14 Identities = 38/57 (66%), Positives = 45/57 (78%) Frame = -1 Query: 176 FSASFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELARKAVFG 6 F A+FPPG RFHP+DEEL+VYYL NKV S +PA +IAD LY Y+PWEL +KA FG Sbjct: 14 FPAAFPPGFRFHPTDEELLVYYLKNKVASRLVPAELIADIDLYQYNPWELPKKAFFG 70 >gb|KCW51403.1| hypothetical protein EUGRSUZ_J00940, partial [Eucalyptus grandis] Length = 233 Score = 85.9 bits (211), Expect = 1e-14 Identities = 38/57 (66%), Positives = 45/57 (78%) Frame = -1 Query: 176 FSASFPPGIRFHPSDEELIVYYLLNKVKSLPLPANVIADTQLYDYDPWELARKAVFG 6 F A+FPPG RFHP+DEEL+VYYL NKV S +PA +IAD LY Y+PWEL +KA FG Sbjct: 14 FPAAFPPGFRFHPTDEELLVYYLKNKVASRLVPAELIADIDLYQYNPWELPKKAFFG 70