BLASTX nr result
ID: Forsythia21_contig00019773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00019773 (672 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516863.1| hypothetical protein GlmaxMp14 (mitochondrio... 259 7e-67 ref|NP_064005.1| orf152 gene product (mitochondrion) [Beta vulga... 203 6e-50 ref|XP_002538339.1| conserved hypothetical protein [Ricinus comm... 123 8e-26 gb|KJB09758.1| hypothetical protein B456_001G164800, partial [Go... 118 3e-24 gb|EXX73671.1| hypothetical protein RirG_058250 [Rhizophagus irr... 117 4e-24 ref|YP_008992289.1| hypothetical protein Salmi_Mp023 (mitochondr... 84 2e-14 emb|CBI23504.3| unnamed protein product [Vitis vinifera] 58 6e-07 >ref|YP_007516863.1| hypothetical protein GlmaxMp14 (mitochondrion) [Glycine max] gi|403311592|gb|AFR34340.1| hypothetical protein GlmaxMp14 (mitochondrion) [Glycine max] Length = 202 Score = 259 bits (663), Expect = 7e-67 Identities = 149/213 (69%), Positives = 156/213 (73%), Gaps = 15/213 (7%) Frame = +3 Query: 6 DLWDI*RSAGLEP-----------YTRGWSRSRLVVPLSMIVDSTLISCLSWIY*SRKPS 152 D WDI RSAGLE YTR WSRSRL VPLSMIVDSTLISCLSW Sbjct: 2 DCWDIRRSAGLERNPIQGAFPQPIYTRCWSRSRLAVPLSMIVDSTLISCLSW-------- 53 Query: 153 IESSNSLSEIFPPPISC----HASSFSESVPGVSQSRFAIKRGKSLYFRLGRSHHSRNSP 320 + + S++ C HAS FSESVP VSQSRFAIKRGKSL FRLGRS HS NSP Sbjct: 54 -RALHPSSQVIRYRKDCRRVSHASCFSESVPSVSQSRFAIKRGKSLDFRLGRSRHSCNSP 112 Query: 321 VHRLITRVRIQSAHSE*KKRSSWILFLNQNVYQLIPIHSVKVSTALSRPSTKRCTMLIGI 500 VHR ITR Q AHSE KKRSSWILFLNQNVY+LIPIHSVKVST PST+RCTMLIGI Sbjct: 113 VHRSITRASSQHAHSERKKRSSWILFLNQNVYKLIPIHSVKVSTG---PSTERCTMLIGI 169 Query: 501 GKDLLVHVLEGSIHGNHH*FLPRA*YGFVLGVV 599 GKDLLVHVLEGSIHGN + FLPRA YGFVLGVV Sbjct: 170 GKDLLVHVLEGSIHGNQNVFLPRAWYGFVLGVV 202 >ref|NP_064005.1| orf152 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435150|ref|YP_004222368.1| hypothetical protein BevumaM_p135 [Beta vulgaris subsp. maritima] gi|346683241|ref|YP_004842173.1| hypothetical protein BemaM_p129 [Beta macrocarpa] gi|9049307|dbj|BAA99317.1| orf152 (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|54606701|dbj|BAD66724.1| orf152 (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|54606745|dbj|BAD66768.1| orf152 (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|317905600|emb|CBJ14007.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439883|emb|CBJ17583.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148037|emb|CBJ20701.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500159|emb|CBX24978.1| hypothetical protein [Beta macrocarpa] gi|384977915|emb|CBL54139.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 152 Score = 203 bits (517), Expect = 6e-50 Identities = 113/159 (71%), Positives = 124/159 (77%), Gaps = 4/159 (2%) Frame = +3 Query: 90 MIVDSTLISCLSWIY*SRKPSIESSNSL---SEIFPPPISCHASSFSESVPGVSQSRFAI 260 MIVDSTLIS LSW+ P++ S+ + ++F HAS FSE VP VSQSRF I Sbjct: 1 MIVDSTLISSLSWV-----PNLHPSSQVIRYRKLFRR--LSHASCFSELVPSVSQSRFTI 53 Query: 261 KRGKSLYFRLGRSHHSRNSPVHRLITRVRIQSAHSE*KKRSSWILFLNQNVY-QLIPIHS 437 RGKSLYFRLGRS HSRN VHR I RVRIQSAHSE KKRSSWILFL +NVY +PIHS Sbjct: 54 TRGKSLYFRLGRSRHSRNFLVHRSIARVRIQSAHSERKKRSSWILFLKKNVYHDSMPIHS 113 Query: 438 VKVSTALSRPSTKRCTMLIGIGKDLLVHVLEGSIHGNHH 554 VKVSTA SRPST+RCTMLIGIGKDLL+HVLEGSIHGNHH Sbjct: 114 VKVSTAFSRPSTERCTMLIGIGKDLLLHVLEGSIHGNHH 152 >ref|XP_002538339.1| conserved hypothetical protein [Ricinus communis] gi|223512664|gb|EEF24045.1| conserved hypothetical protein [Ricinus communis] Length = 153 Score = 123 bits (309), Expect = 8e-26 Identities = 61/67 (91%), Positives = 64/67 (95%) Frame = -2 Query: 662 SRPLRADGDSRTGKSGTRHLLNNTKNKAILCPREKLVMIAMNAALEDVYKKVFADSYQHG 483 +RPLRADGDSRTGKSGTRHLLNNTKNKAI PR+K+VMIAMNAALEDVYKKVFADSYQHG Sbjct: 87 ARPLRADGDSRTGKSGTRHLLNNTKNKAIPYPRDKVVMIAMNAALEDVYKKVFADSYQHG 146 Query: 482 ASLSRGA 462 A LSRGA Sbjct: 147 APLSRGA 153 >gb|KJB09758.1| hypothetical protein B456_001G164800, partial [Gossypium raimondii] Length = 309 Score = 118 bits (296), Expect = 3e-24 Identities = 61/68 (89%), Positives = 62/68 (91%), Gaps = 1/68 (1%) Frame = -2 Query: 662 SRPLRADGDSRTGKSGTRHLLNNTKNKAILCPREKLVMIAMNAALEDV-YKKVFADSYQH 486 +RPLRADGD RTGKSGTRHLLNNTKNKAI CPREK VMIAMNAA EDV YKKVFADSYQH Sbjct: 242 ARPLRADGDYRTGKSGTRHLLNNTKNKAIPCPREKDVMIAMNAAFEDVLYKKVFADSYQH 301 Query: 485 GASLSRGA 462 GA LSRGA Sbjct: 302 GAPLSRGA 309 >gb|EXX73671.1| hypothetical protein RirG_058250 [Rhizophagus irregularis DAOM 197198w] Length = 106 Score = 117 bits (294), Expect = 4e-24 Identities = 57/60 (95%), Positives = 58/60 (96%) Frame = -2 Query: 662 SRPLRADGDSRTGKSGTRHLLNNTKNKAILCPREKLVMIAMNAALEDVYKKVFADSYQHG 483 +RPLRADGDSRTGKSGTRHLLN TKNKAI CPREKLVMIAMNAALEDVYKKVFADSYQHG Sbjct: 44 ARPLRADGDSRTGKSGTRHLLNKTKNKAIPCPREKLVMIAMNAALEDVYKKVFADSYQHG 103 >ref|YP_008992289.1| hypothetical protein Salmi_Mp023 (mitochondrion) [Salvia miltiorrhiza] gi|534292265|gb|AGU16557.1| hypothetical protein Salmi_Mp023 (mitochondrion) [Salvia miltiorrhiza] Length = 124 Score = 84.0 bits (206), Expect(2) = 2e-14 Identities = 43/45 (95%), Positives = 44/45 (97%), Gaps = 1/45 (2%) Frame = +1 Query: 511 FLYTSSRAAFMAIITSFSRG-HSMALFLVLFNRCRVPLFPVRESP 642 FLYTSSRAAFMAIITSFSRG HSMALFLVLF+RCRVPLFPVRESP Sbjct: 10 FLYTSSRAAFMAIITSFSRGGHSMALFLVLFHRCRVPLFPVRESP 54 Score = 22.7 bits (47), Expect(2) = 2e-14 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 479 MHHVDRNR 502 MHHVDRNR Sbjct: 1 MHHVDRNR 8 >emb|CBI23504.3| unnamed protein product [Vitis vinifera] Length = 103 Score = 58.2 bits (139), Expect(2) = 6e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 571 HSMALFLVLFNRCRVPLFPVRESPSALSGR 660 + ALFLVLFNRCRVPLFPVRESPSALSGR Sbjct: 50 YGFALFLVLFNRCRVPLFPVRESPSALSGR 79 Score = 22.7 bits (47), Expect(2) = 6e-07 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 558 FLPRA*YGFVLGVV 599 FLPRA YGF L +V Sbjct: 44 FLPRAWYGFALFLV 57