BLASTX nr result
ID: Forsythia21_contig00019769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00019769 (320 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089028.1| PREDICTED: bis(5'-adenosyl)-triphosphatase-l... 57 5e-06 >ref|XP_011089028.1| PREDICTED: bis(5'-adenosyl)-triphosphatase-like isoform X1 [Sesamum indicum] Length = 205 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/44 (68%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = -1 Query: 320 SLRRRPLTLDQEASHLANCIRENLSFSNNLED-IKGQASSLIGN 192 S++RRPL LDQE S LAN IRENLSF N ED +GQAS+L+GN Sbjct: 162 SIQRRPLKLDQEGSQLANHIRENLSFVNGYEDGSEGQASTLVGN 205