BLASTX nr result
ID: Forsythia21_contig00019715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00019715 (436 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094448.1| PREDICTED: pentatricopeptide repeat-containi... 111 2e-22 ref|XP_012831869.1| PREDICTED: pentatricopeptide repeat-containi... 91 4e-16 emb|CDP15329.1| unnamed protein product [Coffea canephora] 86 1e-14 ref|XP_009602768.1| PREDICTED: pentatricopeptide repeat-containi... 82 2e-13 ref|XP_009798335.1| PREDICTED: pentatricopeptide repeat-containi... 78 2e-12 ref|XP_008386565.1| PREDICTED: pentatricopeptide repeat-containi... 78 2e-12 ref|XP_009378231.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 ref|XP_008241336.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 gb|EYU41565.1| hypothetical protein MIMGU_mgv1a026878mg, partial... 74 4e-11 gb|KMT06407.1| hypothetical protein BVRB_7g160840 [Beta vulgaris... 73 9e-11 ref|XP_010683940.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 73 9e-11 ref|XP_008462517.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_004143370.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_002323489.2| hypothetical protein POPTR_0016s11000g [Popu... 71 3e-10 ref|XP_007203128.1| hypothetical protein PRUPE_ppa024044mg [Prun... 71 3e-10 ref|XP_006347831.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-10 ref|XP_002277923.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 emb|CBI30210.3| unnamed protein product [Vitis vinifera] 69 9e-10 ref|XP_010098867.1| hypothetical protein L484_022634 [Morus nota... 69 1e-09 ref|XP_002528626.1| pentatricopeptide repeat-containing protein,... 68 3e-09 >ref|XP_011094448.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Sesamum indicum] Length = 903 Score = 111 bits (278), Expect = 2e-22 Identities = 63/118 (53%), Positives = 80/118 (67%), Gaps = 1/118 (0%) Frame = -2 Query: 354 PSQVSSYHS-IXXXXXXXXXXPQLFSNPPVLLSKLPSFQPLFTPKPLETSHETSQTSLNH 178 PSQ++SY S PQLFSNP LSK PSFQ L +PKPLE S S NH Sbjct: 38 PSQITSYLSPSKSPLSISSPRPQLFSNPSSSLSKTPSFQHLSSPKPLENSQPLS----NH 93 Query: 177 DFSHLLRLSFRYTDVQFNKAVHASILKIEEDTYLFNALITSYLKLGHINYAQKVFRAL 4 + S LL+LS Y D+Q +KAVHASILK++ DT LFN+LITSY++LG ++YA+ VF ++ Sbjct: 94 ELSRLLKLSCDYIDIQLSKAVHASILKVQHDTRLFNSLITSYIELGCLSYAENVFSSI 151 >ref|XP_012831869.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Erythranthe guttatus] Length = 894 Score = 90.5 bits (223), Expect = 4e-16 Identities = 55/118 (46%), Positives = 69/118 (58%), Gaps = 1/118 (0%) Frame = -2 Query: 354 PSQVSSYHS-IXXXXXXXXXXPQLFSNPPVLLSKLPSFQPLFTPKPLETSHETSQTSLNH 178 PSQV+SY S P F P LSK S TPK L+ S S NH Sbjct: 33 PSQVTSYLSPSKTPLSLSSSNPHFFPYPSFSLSKFSS-----TPKKLDNSQPLS----NH 83 Query: 177 DFSHLLRLSFRYTDVQFNKAVHASILKIEEDTYLFNALITSYLKLGHINYAQKVFRAL 4 + S LL+LS Y D+Q KAVHAS+LK E+D LFN+LITSY +LG +NYA++VF ++ Sbjct: 84 ELSRLLKLSIEYADIQLGKAVHASVLKFEQDVRLFNSLITSYFELGKLNYAERVFDSI 141 >emb|CDP15329.1| unnamed protein product [Coffea canephora] Length = 905 Score = 85.9 bits (211), Expect = 1e-14 Identities = 51/97 (52%), Positives = 63/97 (64%) Frame = -2 Query: 291 QLFSNPPVLLSKLPSFQPLFTPKPLETSHETSQTSLNHDFSHLLRLSFRYTDVQFNKAVH 112 Q +P + SK P PL P E S +T S +D+SHLL LS RY DV+ KAVH Sbjct: 61 QFLPSPSISPSKSP---PLDLPLTSEPSIKTDLPS--NDYSHLLLLSARYGDVELAKAVH 115 Query: 111 ASILKIEEDTYLFNALITSYLKLGHINYAQKVFRALS 1 ASI K EEDTYL NALI +YLKLG I++A +VF+ +S Sbjct: 116 ASIFKHEEDTYLSNALIVAYLKLGRIDFAHRVFKNMS 152 >ref|XP_009602768.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Nicotiana tomentosiformis] Length = 890 Score = 81.6 bits (200), Expect = 2e-13 Identities = 45/88 (51%), Positives = 60/88 (68%), Gaps = 2/88 (2%) Frame = -2 Query: 261 SKLPSFQPLFTPKPLETSHETSQTSLNH-DFSHLLRLSFRYTDVQFNKAVHASILKIEE- 88 SK FQPL P+ + S+ T N D+++LLR+S R DV+ K +H+SILK+EE Sbjct: 51 SKSRPFQPLLIPQHFKDSNVTVAADTNRIDYANLLRISVRCGDVELAKIIHSSILKLEEE 110 Query: 87 DTYLFNALITSYLKLGHINYAQKVFRAL 4 D YL NALI +YLKLGH+N A+KVF +L Sbjct: 111 DVYLKNALIAAYLKLGHLNLAEKVFDSL 138 >ref|XP_009798335.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Nicotiana sylvestris] Length = 890 Score = 78.2 bits (191), Expect = 2e-12 Identities = 44/88 (50%), Positives = 58/88 (65%), Gaps = 2/88 (2%) Frame = -2 Query: 261 SKLPSFQPLFTPKPLETSHETSQTSLNH-DFSHLLRLSFRYTDVQFNKAVHASILKIEE- 88 SK FQPL P+ + S T D+++LLR+S R DV+ K +H+SILK+EE Sbjct: 51 SKSRPFQPLLIPQHFKDSFVTVGADTTRIDYANLLRISVRCGDVELAKIIHSSILKLEEE 110 Query: 87 DTYLFNALITSYLKLGHINYAQKVFRAL 4 D YL NALI +YLKLGH+N A+KVF +L Sbjct: 111 DVYLKNALIAAYLKLGHLNLAEKVFDSL 138 >ref|XP_008386565.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Malus domestica] gi|657988770|ref|XP_008386567.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Malus domestica] Length = 905 Score = 78.2 bits (191), Expect = 2e-12 Identities = 44/85 (51%), Positives = 57/85 (67%) Frame = -2 Query: 255 LPSFQPLFTPKPLETSHETSQTSLNHDFSHLLRLSFRYTDVQFNKAVHASILKIEEDTYL 76 LPS QPL P H+T + H HLLRLS R+ D + +AVHASILK++EDT+L Sbjct: 73 LPSPQPLLKSNPPNDRHQTHK--FFHHLIHLLRLSARHGDRELARAVHASILKLQEDTHL 130 Query: 75 FNALITSYLKLGHINYAQKVFRALS 1 NALI++YLKLG ++ A VF +LS Sbjct: 131 GNALISAYLKLGLVSDAHLVFLSLS 155 >ref|XP_009378231.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Pyrus x bretschneideri] Length = 906 Score = 77.4 bits (189), Expect = 3e-12 Identities = 43/90 (47%), Positives = 57/90 (63%) Frame = -2 Query: 270 VLLSKLPSFQPLFTPKPLETSHETSQTSLNHDFSHLLRLSFRYTDVQFNKAVHASILKIE 91 + LPS QPL P H+T + H HLLRLS R+ D + +A HASILK++ Sbjct: 68 IQFQSLPSPQPLLNSNPPNDRHQTHK--FLHHLIHLLRLSARHGDRELARAAHASILKLQ 125 Query: 90 EDTYLFNALITSYLKLGHINYAQKVFRALS 1 EDT+L NALI++YLKLG ++ A VF +LS Sbjct: 126 EDTHLGNALISAYLKLGLVSDAHLVFLSLS 155 >ref|XP_008241336.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Prunus mume] Length = 905 Score = 74.3 bits (181), Expect = 3e-11 Identities = 48/98 (48%), Positives = 62/98 (63%), Gaps = 6/98 (6%) Frame = -2 Query: 276 PPVLLS--KLPSFQPLFTPKPLETSHETSQTSLNHDFSH----LLRLSFRYTDVQFNKAV 115 P VLL+ LP Q L T KPL + + H F H LLRLS R+ D + +AV Sbjct: 57 PQVLLNFTALPPSQSLPTEKPLLPLTPPNGSDQTHFFFHHLLNLLRLSARHGDHELARAV 116 Query: 114 HASILKIEEDTYLFNALITSYLKLGHINYAQKVFRALS 1 HASILK+EED +L NALI++YLKLG + A +VF++LS Sbjct: 117 HASILKLEEDNHLGNALISAYLKLGLVPDADRVFQSLS 154 >gb|EYU41565.1| hypothetical protein MIMGU_mgv1a026878mg, partial [Erythranthe guttata] Length = 722 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/56 (58%), Positives = 44/56 (78%) Frame = -2 Query: 171 SHLLRLSFRYTDVQFNKAVHASILKIEEDTYLFNALITSYLKLGHINYAQKVFRAL 4 S LL+LS Y D+Q KAVHAS+LK E+D LFN+LITSY +LG +NYA++VF ++ Sbjct: 2 SRLLKLSIEYADIQLGKAVHASVLKFEQDVRLFNSLITSYFELGKLNYAERVFDSI 57 >gb|KMT06407.1| hypothetical protein BVRB_7g160840 [Beta vulgaris subsp. vulgaris] Length = 795 Score = 72.8 bits (177), Expect = 9e-11 Identities = 42/103 (40%), Positives = 61/103 (59%), Gaps = 9/103 (8%) Frame = -2 Query: 282 SNPPVLLSKLPSFQPLF--TPKPLETSHETSQTSLNHDFS-------HLLRLSFRYTDVQ 130 S+PP LS P F PL+ T P +S+ + + D LL+LS RY DV+ Sbjct: 45 SSPPHFLSN-PQFSPLYQQTHLPFSSSNSPENSLSSEDVQFLYNKCLELLQLSVRYNDVE 103 Query: 129 FNKAVHASILKIEEDTYLFNALITSYLKLGHINYAQKVFRALS 1 +A+H+ ILK++ED YL N+LIT+Y+KLG ++ A VF +S Sbjct: 104 LARALHSLILKLQEDNYLLNSLITAYIKLGFLSDAYNVFSGIS 146 >ref|XP_010683940.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g03800 [Beta vulgaris subsp. vulgaris] Length = 899 Score = 72.8 bits (177), Expect = 9e-11 Identities = 42/103 (40%), Positives = 61/103 (59%), Gaps = 9/103 (8%) Frame = -2 Query: 282 SNPPVLLSKLPSFQPLF--TPKPLETSHETSQTSLNHDFS-------HLLRLSFRYTDVQ 130 S+PP LS P F PL+ T P +S+ + + D LL+LS RY DV+ Sbjct: 45 SSPPHFLSN-PQFSPLYQQTHLPFSSSNSPENSLSSEDVQFLYNKCLELLQLSVRYNDVE 103 Query: 129 FNKAVHASILKIEEDTYLFNALITSYLKLGHINYAQKVFRALS 1 +A+H+ ILK++ED YL N+LIT+Y+KLG ++ A VF +S Sbjct: 104 LARALHSLILKLQEDNYLLNSLITAYIKLGFLSDAYNVFSGIS 146 >ref|XP_008462517.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Cucumis melo] Length = 905 Score = 72.4 bits (176), Expect = 1e-10 Identities = 41/81 (50%), Positives = 51/81 (62%) Frame = -2 Query: 243 QPLFTPKPLETSHETSQTSLNHDFSHLLRLSFRYTDVQFNKAVHASILKIEEDTYLFNAL 64 +PLF +PL TS T + + LLRLS RY D +AVHA LK+EED +L NAL Sbjct: 79 EPLFASRPLNTSLSTVASPFD-----LLRLSTRYGDPDLARAVHAQFLKLEEDIFLGNAL 133 Query: 63 ITSYLKLGHINYAQKVFRALS 1 I++YLKLG + A KVF LS Sbjct: 134 ISAYLKLGLVRDADKVFSGLS 154 >ref|XP_004143370.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Cucumis sativus] gi|700193015|gb|KGN48219.1| hypothetical protein Csa_6G449260 [Cucumis sativus] Length = 908 Score = 72.0 bits (175), Expect = 1e-10 Identities = 45/97 (46%), Positives = 58/97 (59%) Frame = -2 Query: 291 QLFSNPPVLLSKLPSFQPLFTPKPLETSHETSQTSLNHDFSHLLRLSFRYTDVQFNKAVH 112 Q F++P L+S +PLF + L TS T + + LLRLS RY D +AVH Sbjct: 69 QFFTSPQHLVSLS---EPLFASRSLNTSLSTIASPFD-----LLRLSTRYGDPDLARAVH 120 Query: 111 ASILKIEEDTYLFNALITSYLKLGHINYAQKVFRALS 1 A LK+EED +L NALI++YLKLG + A KVF LS Sbjct: 121 AQFLKLEEDIFLGNALISAYLKLGLVRDADKVFSGLS 157 >ref|XP_002323489.2| hypothetical protein POPTR_0016s11000g [Populus trichocarpa] gi|550321242|gb|EEF05250.2| hypothetical protein POPTR_0016s11000g [Populus trichocarpa] Length = 915 Score = 70.9 bits (172), Expect = 3e-10 Identities = 40/102 (39%), Positives = 65/102 (63%), Gaps = 5/102 (4%) Frame = -2 Query: 291 QLFSNPPVLLSKLPSFQPLFTPKPLETSHETSQTSLN-----HDFSHLLRLSFRYTDVQF 127 Q + P+ L+K + + F PL++++ + QT+ + D +LLRLS +YTD+ Sbjct: 66 QFLLSSPLSLTKPQNLESSF---PLDSNYHSPQTNTDCLIEVDDLFNLLRLSVKYTDIDL 122 Query: 126 NKAVHASILKIEEDTYLFNALITSYLKLGHINYAQKVFRALS 1 +A+HASILK+ EDT+L NA+I +Y+KLG + A +VF +S Sbjct: 123 ARALHASILKLGEDTHLGNAVIAAYIKLGLVVDAYEVFMGMS 164 >ref|XP_007203128.1| hypothetical protein PRUPE_ppa024044mg [Prunus persica] gi|462398659|gb|EMJ04327.1| hypothetical protein PRUPE_ppa024044mg [Prunus persica] Length = 905 Score = 70.9 bits (172), Expect = 3e-10 Identities = 48/98 (48%), Positives = 63/98 (64%), Gaps = 6/98 (6%) Frame = -2 Query: 276 PPVLLS--KLPSFQPLFTPKPL---ETSHETSQTS-LNHDFSHLLRLSFRYTDVQFNKAV 115 P +LL+ LP Q L T KPL + + QT L H +LLRLS R+ D + +AV Sbjct: 57 PQLLLNFTALPPSQSLPTQKPLLPLTPPNGSDQTHFLFHHLLNLLRLSARHGDHELARAV 116 Query: 114 HASILKIEEDTYLFNALITSYLKLGHINYAQKVFRALS 1 HASILK EED +L NALI++YLKLG + A +VF++LS Sbjct: 117 HASILKFEEDNHLGNALISAYLKLGLVPDAYRVFQSLS 154 >ref|XP_006347831.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Solanum tuberosum] Length = 894 Score = 70.1 bits (170), Expect = 6e-10 Identities = 39/88 (44%), Positives = 58/88 (65%), Gaps = 2/88 (2%) Frame = -2 Query: 261 SKLPSFQPLFTPKPLETSHETSQTSLNH-DFSHLLRLSFRYTDVQFNKAVHASILKIEE- 88 SK QPL TP+ + S+ + + N D+++LLR+S R DV K +H+S++K EE Sbjct: 54 SKYHLVQPLLTPQQFKDSNVSVDSDTNCIDYANLLRISVRCGDVVLTKIIHSSLVKFEEE 113 Query: 87 DTYLFNALITSYLKLGHINYAQKVFRAL 4 D YL NALI +Y+KLG +N A++VF +L Sbjct: 114 DVYLKNALIAAYIKLGCLNLAERVFDSL 141 >ref|XP_002277923.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Vitis vinifera] Length = 882 Score = 69.3 bits (168), Expect = 9e-10 Identities = 45/94 (47%), Positives = 53/94 (56%) Frame = -2 Query: 282 SNPPVLLSKLPSFQPLFTPKPLETSHETSQTSLNHDFSHLLRLSFRYTDVQFNKAVHASI 103 SN P LLS PS S ++N D +LL LS RY DV+ KAVHASI Sbjct: 55 SNQPALLSNFPS---------------VSNDTVN-DHYYLLDLSVRYDDVELIKAVHASI 98 Query: 102 LKIEEDTYLFNALITSYLKLGHINYAQKVFRALS 1 K+ ED +L NALI +YLKLG + A KVF LS Sbjct: 99 FKLAEDIHLANALIVAYLKLGMVPNAYKVFVGLS 132 >emb|CBI30210.3| unnamed protein product [Vitis vinifera] Length = 900 Score = 69.3 bits (168), Expect = 9e-10 Identities = 45/94 (47%), Positives = 53/94 (56%) Frame = -2 Query: 282 SNPPVLLSKLPSFQPLFTPKPLETSHETSQTSLNHDFSHLLRLSFRYTDVQFNKAVHASI 103 SN P LLS PS S ++N D +LL LS RY DV+ KAVHASI Sbjct: 73 SNQPALLSNFPS---------------VSNDTVN-DHYYLLDLSVRYDDVELIKAVHASI 116 Query: 102 LKIEEDTYLFNALITSYLKLGHINYAQKVFRALS 1 K+ ED +L NALI +YLKLG + A KVF LS Sbjct: 117 FKLAEDIHLANALIVAYLKLGMVPNAYKVFVGLS 150 >ref|XP_010098867.1| hypothetical protein L484_022634 [Morus notabilis] gi|587887154|gb|EXB75955.1| hypothetical protein L484_022634 [Morus notabilis] Length = 911 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/56 (57%), Positives = 45/56 (80%) Frame = -2 Query: 168 HLLRLSFRYTDVQFNKAVHASILKIEEDTYLFNALITSYLKLGHINYAQKVFRALS 1 HLL+LS RY DV+ KAVHAS++K+ ED YL N+LI++YLKLG ++ A +VF A++ Sbjct: 105 HLLQLSVRYNDVELAKAVHASVVKLGEDVYLGNSLISAYLKLGFVSEAYEVFMAMA 160 >ref|XP_002528626.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531915|gb|EEF33729.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 537 Score = 67.8 bits (164), Expect = 3e-09 Identities = 40/91 (43%), Positives = 54/91 (59%), Gaps = 3/91 (3%) Frame = -2 Query: 267 LLSKLPSFQPLFTPKPLETSHETSQTSLNHDFSHLL---RLSFRYTDVQFNKAVHASILK 97 LLS P+ +PL H T ++ HLL R+S RYTD +A+HASILK Sbjct: 54 LLSSNPTLSSHRNIEPLFGLHSKYDTFIDIGIDHLLNLLRISVRYTDFDLARALHASILK 113 Query: 96 IEEDTYLFNALITSYLKLGHINYAQKVFRAL 4 + EDT+L NAL+ +YLKLG + A +VF+ L Sbjct: 114 LGEDTHLGNALVVAYLKLGLVLDAYEVFKGL 144