BLASTX nr result
ID: Forsythia21_contig00019216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00019216 (219 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ59019.1| ribosomal protein S12/S23 [Aureobasidium melanoge... 119 1e-24 ref|XP_001795358.1| hypothetical protein SNOG_04945 [Phaeosphaer... 112 7e-23 gb|KKY25095.1| putative 40s ribosomal protein s23 [Phaeomoniella... 111 2e-22 ref|XP_007689758.1| hypothetical protein COCMIDRAFT_27834 [Bipol... 111 2e-22 ref|XP_003013890.1| hypothetical protein ARB_08002 [Arthroderma ... 110 4e-22 ref|XP_002842688.1| 40S ribosomal protein S23 [Arthroderma otae ... 110 4e-22 ref|XP_001217153.1| 40S ribosomal protein S23 [Aspergillus terre... 109 6e-22 ref|XP_002797846.1| 40S ribosomal protein S23 [Paracoccidioides ... 109 6e-22 ref|XP_003169122.1| 40S ribosomal protein S23 [Microsporum gypse... 109 8e-22 ref|XP_002625811.1| 40S ribosomal protein S23 [Blastomyces derma... 109 8e-22 ref|XP_658949.1| RS23_NEUCR 40S ribosomal protein S23 [Aspergill... 108 1e-21 ref|XP_007778109.1| 40S ribosomal protein S23 [Coniosporium apol... 108 1e-21 ref|XP_007799759.1| 40S ribosomal protein S23 [Endocarpon pusill... 108 1e-21 ref|XP_001544900.1| 40S ribosomal protein S23 [Histoplasma capsu... 108 1e-21 gb|KIW05201.1| 40S ribosomal protein S23 [Verruconis gallopava] 108 2e-21 gb|ADG23119.1| ribosomal protein S23, partial [Rhizoplaca chryso... 108 2e-21 dbj|GAD95324.1| 40S ribosomal protein S23 [Byssochlamys spectabi... 108 2e-21 ref|XP_001588322.1| 40S ribosomal protein S23 [Sclerotinia scler... 107 2e-21 emb|CAB56815.1| ribosomal protein S28 [Aspergillus niger] 107 3e-21 ref|XP_001392215.1| 40S ribosomal protein S23 [Aspergillus niger... 107 3e-21 >gb|KEQ59019.1| ribosomal protein S12/S23 [Aureobasidium melanogenum CBS 110374] gi|662517495|gb|KEQ75057.1| ribosomal protein S12/S23 [Aureobasidium namibiae CBS 147.97] gi|662529154|gb|KEQ86530.1| ribosomal protein S12/S23 [Aureobasidium pullulans EXF-150] gi|662536719|gb|KEQ94030.1| hypothetical protein AUEXF2481DRAFT_89842 [Aureobasidium subglaciale EXF-2481] Length = 145 Score = 119 bits (297), Expect = 1e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV Sbjct: 1 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 57 >ref|XP_001795358.1| hypothetical protein SNOG_04945 [Phaeosphaeria nodorum SN15] gi|189196308|ref|XP_001934492.1| 40S ribosomal protein S23 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330921664|ref|XP_003299517.1| 40S ribosomal protein S23 [Pyrenophora teres f. teres 0-1] gi|615407717|ref|XP_007582428.1| putative 40s ribosomal protein s23 protein [Neofusicoccum parvum UCRNP2] gi|111066216|gb|EAT87336.1| hypothetical protein SNOG_04945 [Phaeosphaeria nodorum SN15] gi|187980371|gb|EDU46997.1| 40S ribosomal protein S23 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311326782|gb|EFQ92391.1| hypothetical protein PTT_10522 [Pyrenophora teres f. teres 0-1] gi|407928440|gb|EKG21296.1| Ribosomal protein S23 eukaryotic/archaeal [Macrophomina phaseolina MS6] gi|485925551|gb|EOD50090.1| putative 40s ribosomal protein s23 protein [Neofusicoccum parvum UCRNP2] gi|821072426|gb|KKY27392.1| putative 40s ribosomal protein s23 [Diplodia seriata] Length = 145 Score = 112 bits (281), Expect = 7e-23 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKGKPRGLNAARKL+N RREGRWADL+YKKRLLGTAYKSSPFGGSSHAKGIVLEKV Sbjct: 1 MGKGKPRGLNAARKLRNHRREGRWADLHYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 57 >gb|KKY25095.1| putative 40s ribosomal protein s23 [Phaeomoniella chlamydospora] Length = 145 Score = 111 bits (277), Expect = 2e-22 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKGKPRGLNAARKL+N RREGRWADL+YKKRLLGTA+KSSPFGGSSHAKGIVLEKV Sbjct: 1 MGKGKPRGLNAARKLRNHRREGRWADLSYKKRLLGTAFKSSPFGGSSHAKGIVLEKV 57 >ref|XP_007689758.1| hypothetical protein COCMIDRAFT_27834 [Bipolaris oryzae ATCC 44560] gi|628084362|ref|XP_007704031.1| hypothetical protein COCSADRAFT_30037 [Bipolaris sorokiniana ND90Pr] gi|628231244|ref|XP_007716414.1| hypothetical protein COCCADRAFT_8498 [Bipolaris zeicola 26-R-13] gi|451846680|gb|EMD59989.1| hypothetical protein COCSADRAFT_30037 [Bipolaris sorokiniana ND90Pr] gi|452005187|gb|EMD97643.1| hypothetical protein COCHEDRAFT_1190431 [Bipolaris maydis C5] gi|477585872|gb|ENI02959.1| hypothetical protein COCC4DRAFT_25634 [Bipolaris maydis ATCC 48331] gi|576914951|gb|EUC29276.1| hypothetical protein COCCADRAFT_8498 [Bipolaris zeicola 26-R-13] gi|576930115|gb|EUC43704.1| hypothetical protein COCMIDRAFT_27834 [Bipolaris oryzae ATCC 44560] gi|578486559|gb|EUN24031.1| hypothetical protein COCVIDRAFT_18509 [Bipolaris victoriae FI3] Length = 145 Score = 111 bits (277), Expect = 2e-22 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKGKPRGLNAARKL+N RREGRWADL+YKKRLLGTA+KSSPFGGSSHAKGIVLEKV Sbjct: 1 MGKGKPRGLNAARKLRNHRREGRWADLHYKKRLLGTAFKSSPFGGSSHAKGIVLEKV 57 >ref|XP_003013890.1| hypothetical protein ARB_08002 [Arthroderma benhamiae CBS 112371] gi|302659189|ref|XP_003021288.1| hypothetical protein TRV_04601 [Trichophyton verrucosum HKI 0517] gi|327302234|ref|XP_003235809.1| 40S ribosomal protein S23 [Trichophyton rubrum CBS 118892] gi|291177456|gb|EFE33250.1| hypothetical protein ARB_08002 [Arthroderma benhamiae CBS 112371] gi|291185179|gb|EFE40670.1| hypothetical protein TRV_04601 [Trichophyton verrucosum HKI 0517] gi|326461151|gb|EGD86604.1| 40S ribosomal protein S23 [Trichophyton rubrum CBS 118892] gi|326470019|gb|EGD94028.1| ribosomal protein S12 [Trichophyton tonsurans CBS 112818] gi|326482771|gb|EGE06781.1| 40S ribosomal protein S23 [Trichophyton equinum CBS 127.97] gi|607876764|gb|EZF21940.1| 40S ribosomal protein S23 [Trichophyton rubrum MR850] gi|607898186|gb|EZF36457.1| 40S ribosomal protein S23 [Trichophyton interdigitale H6] gi|607898187|gb|EZF36458.1| 40S ribosomal protein S23 [Trichophyton interdigitale H6] gi|607903507|gb|EZF40990.1| 40S ribosomal protein S23 [Trichophyton rubrum CBS 100081] gi|607915589|gb|EZF51615.1| 40S ribosomal protein S23 [Trichophyton rubrum CBS 288.86] gi|607927659|gb|EZF62241.1| 40S ribosomal protein S23 [Trichophyton rubrum CBS 289.86] gi|607939582|gb|EZF72861.1| 40S ribosomal protein S23 [Trichophyton soudanense CBS 452.61] gi|607951653|gb|EZF83575.1| 40S ribosomal protein S23 [Trichophyton rubrum MR1448] gi|607963771|gb|EZF94228.1| 40S ribosomal protein S23 [Trichophyton rubrum MR1459] gi|607975992|gb|EZG05203.1| 40S ribosomal protein S23 [Trichophyton rubrum CBS 735.88] gi|607987811|gb|EZG15827.1| 40S ribosomal protein S23 [Trichophyton rubrum CBS 202.88] gi|633048083|gb|KDB24479.1| 40S ribosomal protein S23 [Trichophyton interdigitale MR816] gi|633048084|gb|KDB24480.1| 40S ribosomal protein S23 [Trichophyton interdigitale MR816] gi|633057839|gb|KDB32738.1| 40S ribosomal protein S23 [Trichophyton rubrum D6] gi|861303914|gb|KMQ48011.1| Ribosomal protein S23, eukaryotic/archaeal [Trichophyton rubrum] Length = 145 Score = 110 bits (275), Expect = 4e-22 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKGKPRGLNAARKL+N RREGRWADL+YKKRLLGTA+KSSPFGGSSHAKGIV+EKV Sbjct: 1 MGKGKPRGLNAARKLRNHRREGRWADLHYKKRLLGTAFKSSPFGGSSHAKGIVIEKV 57 >ref|XP_002842688.1| 40S ribosomal protein S23 [Arthroderma otae CBS 113480] gi|238846038|gb|EEQ35700.1| ribosomal protein S23 [Arthroderma otae CBS 113480] Length = 145 Score = 110 bits (275), Expect = 4e-22 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKGKPRGLNAARKL+N RREGRWADL+YKKRLLGTA+KSSPFGGSSHAKGIV+EKV Sbjct: 1 MGKGKPRGLNAARKLRNHRREGRWADLSYKKRLLGTAFKSSPFGGSSHAKGIVIEKV 57 >ref|XP_001217153.1| 40S ribosomal protein S23 [Aspergillus terreus NIH2624] gi|169763938|ref|XP_001727869.1| 40S ribosomal protein S23 [Aspergillus oryzae RIB40] gi|238489911|ref|XP_002376193.1| 40S ribosomal protein S23 [Aspergillus flavus NRRL3357] gi|83770897|dbj|BAE61030.1| unnamed protein product [Aspergillus oryzae RIB40] gi|114188999|gb|EAU30699.1| 40S ribosomal protein S23 [Aspergillus terreus NIH2624] gi|220698581|gb|EED54921.1| ribosomal protein S23 (S12) [Aspergillus flavus NRRL3357] gi|391871127|gb|EIT80292.1| 40S ribosomal protein [Aspergillus oryzae 3.042] gi|635504986|gb|KDE77065.1| 40S ribosomal protein [Aspergillus oryzae 100-8] gi|770309269|gb|KJK66474.1| hypothetical protein P875_00021368 [Aspergillus parasiticus SU-1] Length = 145 Score = 109 bits (273), Expect = 6e-22 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKG+PRGLNAARKL NTRRE RWADL+YKKRLLGTAYKSSPFGG+SHAKGIVLEKV Sbjct: 1 MGKGQPRGLNAARKLANTRRENRWADLHYKKRLLGTAYKSSPFGGASHAKGIVLEKV 57 >ref|XP_002797846.1| 40S ribosomal protein S23 [Paracoccidioides sp. 'lutzii' Pb01] gi|226280496|gb|EEH36062.1| 40S ribosomal protein S23 [Paracoccidioides sp. 'lutzii' Pb01] gi|821512866|gb|KKZ68742.1| 40S ribosomal protein S23 [Emmonsia crescens UAMH 3008] Length = 145 Score = 109 bits (273), Expect = 6e-22 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKGKPRGLNAARKL+N RREG+WADL YKKRLLGTA+KSSPFGGSSHAKGIVLEKV Sbjct: 1 MGKGKPRGLNAARKLRNHRREGKWADLTYKKRLLGTAFKSSPFGGSSHAKGIVLEKV 57 >ref|XP_003169122.1| 40S ribosomal protein S23 [Microsporum gypseum CBS 118893] gi|311337543|gb|EFQ96745.1| 30S ribosomal protein S26e [Microsporum gypseum CBS 118893] Length = 145 Score = 109 bits (272), Expect = 8e-22 Identities = 51/57 (89%), Positives = 56/57 (98%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKGKPRGLNAARKL+N RR+GRWADL+YKKRLLGTA+KSSPFGGSSHAKGIV+EKV Sbjct: 1 MGKGKPRGLNAARKLRNHRRDGRWADLHYKKRLLGTAFKSSPFGGSSHAKGIVIEKV 57 >ref|XP_002625811.1| 40S ribosomal protein S23 [Blastomyces dermatitidis SLH14081] gi|239594963|gb|EEQ77544.1| 30S ribosomal protein S23 [Blastomyces dermatitidis SLH14081] gi|239609914|gb|EEQ86901.1| 30S ribosomal protein S23 [Blastomyces dermatitidis ER-3] gi|327350836|gb|EGE79693.1| 40S ribosomal protein S23 [Blastomyces dermatitidis ATCC 18188] gi|531980149|gb|EQL30736.1| 40S ribosomal protein S23 [Blastomyces dermatitidis ATCC 26199] gi|824376220|gb|KLJ13651.1| 40S ribosomal protein S23 [Emmonsia parva UAMH 139] Length = 145 Score = 109 bits (272), Expect = 8e-22 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKG+PRGLNAARKL+N RREGRWADL YKKRLLGTA+KSSPFGGSSHAKGIVLEKV Sbjct: 1 MGKGQPRGLNAARKLRNHRREGRWADLTYKKRLLGTAFKSSPFGGSSHAKGIVLEKV 57 >ref|XP_658949.1| RS23_NEUCR 40S ribosomal protein S23 [Aspergillus nidulans FGSC A4] gi|40746372|gb|EAA65528.1| RS23_NEUCR 40S ribosomal protein S23 [Aspergillus nidulans FGSC A4] gi|259488322|tpe|CBF87676.1| TPA: 40S ribosomal protein S23 (Broad) [Aspergillus nidulans FGSC A4] Length = 145 Score = 108 bits (271), Expect = 1e-21 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKGKPRGLNAARKL TRRE RWADL+YKKRLLGTAYKSSPFGG+SHAKGIVLEKV Sbjct: 1 MGKGKPRGLNAARKLATTRRENRWADLHYKKRLLGTAYKSSPFGGASHAKGIVLEKV 57 >ref|XP_007778109.1| 40S ribosomal protein S23 [Coniosporium apollinis CBS 100218] gi|494825638|gb|EON62792.1| 40S ribosomal protein S23 [Coniosporium apollinis CBS 100218] Length = 145 Score = 108 bits (271), Expect = 1e-21 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKGKPRGLNAARKL+N RREGRW+DL +KKRLLGTAYKSSPFGGSSHAKGIVLEKV Sbjct: 1 MGKGKPRGLNAARKLRNHRREGRWSDLAFKKRLLGTAYKSSPFGGSSHAKGIVLEKV 57 >ref|XP_007799759.1| 40S ribosomal protein S23 [Endocarpon pusillum Z07020] gi|539439008|gb|ERF74658.1| 40S ribosomal protein S23 [Endocarpon pusillum Z07020] Length = 145 Score = 108 bits (270), Expect = 1e-21 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 M KGKPRGLNAARKL+ TRREGRWADL+YKKRLLGTA+KSSPFGGSSHAKGIVLEKV Sbjct: 1 MTKGKPRGLNAARKLKTTRREGRWADLHYKKRLLGTAFKSSPFGGSSHAKGIVLEKV 57 >ref|XP_001544900.1| 40S ribosomal protein S23 [Histoplasma capsulatum NAm1] gi|150408541|gb|EDN04082.1| ribosomal protein S23 [Histoplasma capsulatum NAm1] gi|225557787|gb|EEH06072.1| ribosomal protein S23 [Histoplasma capsulatum G186AR] gi|240274099|gb|EER37617.1| 40S ribosomal protein S23 [Histoplasma capsulatum H143] gi|325095518|gb|EGC48828.1| ribosomal protein S23 [Histoplasma capsulatum H88] Length = 145 Score = 108 bits (270), Expect = 1e-21 Identities = 51/57 (89%), Positives = 55/57 (96%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKGKPRGLNAARKL+N RR+G+WADL YKKRLLGTA+KSSPFGGSSHAKGIVLEKV Sbjct: 1 MGKGKPRGLNAARKLRNHRRDGKWADLTYKKRLLGTAFKSSPFGGSSHAKGIVLEKV 57 >gb|KIW05201.1| 40S ribosomal protein S23 [Verruconis gallopava] Length = 145 Score = 108 bits (269), Expect = 2e-21 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKGKPRGLNAARKL+N RRE +WADL+YKKRLLGTAYKSSPFGGSSHAKGIVLEKV Sbjct: 1 MGKGKPRGLNAARKLRNHRREQQWADLHYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 57 >gb|ADG23119.1| ribosomal protein S23, partial [Rhizoplaca chrysoleuca] Length = 145 Score = 108 bits (269), Expect = 2e-21 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKGKPRGLNA RKL+ RREGRWADL+YKKRLLGTAYKSSPFGGSSHAKGIVLEKV Sbjct: 1 MGKGKPRGLNADRKLRTHRREGRWADLHYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 57 >dbj|GAD95324.1| 40S ribosomal protein S23 [Byssochlamys spectabilis No. 5] Length = 188 Score = 108 bits (269), Expect = 2e-21 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKGKPRGLNAARKL+N RRE RWADL++KKRLLGTAYKSSPFGGSSHAKGIVLEKV Sbjct: 1 MGKGKPRGLNAARKLRNHRREERWADLSFKKRLLGTAYKSSPFGGSSHAKGIVLEKV 57 >ref|XP_001588322.1| 40S ribosomal protein S23 [Sclerotinia sclerotiorum 1980 UF-70] gi|154695156|gb|EDN94894.1| 40S ribosomal protein S23 [Sclerotinia sclerotiorum 1980 UF-70] gi|563295503|gb|ESZ95743.1| 40S ribosomal protein S23 [Sclerotinia borealis F-4157] Length = 145 Score = 107 bits (268), Expect = 2e-21 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKGKPRGLNAARKLQN RRE RWADL+YKKR LGTA+KSSPFGGSSHAKGIVLEKV Sbjct: 1 MGKGKPRGLNAARKLQNHRREQRWADLSYKKRALGTAFKSSPFGGSSHAKGIVLEKV 57 >emb|CAB56815.1| ribosomal protein S28 [Aspergillus niger] Length = 145 Score = 107 bits (267), Expect = 3e-21 Identities = 51/57 (89%), Positives = 54/57 (94%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKG+PRGLNAARKL TRRE RWADL+YKKRLLGTAYKSSPFGG+SHAKGIVLEKV Sbjct: 1 MGKGQPRGLNAARKLATTRRENRWADLHYKKRLLGTAYKSSPFGGASHAKGIVLEKV 57 >ref|XP_001392215.1| 40S ribosomal protein S23 [Aspergillus niger CBS 513.88] gi|134076718|emb|CAK45249.1| ribosomal protein of the small subunit rps28-Aspergillus niger [Aspergillus niger] gi|350629406|gb|EHA17779.1| hypothetical protein ASPNIDRAFT_208439 [Aspergillus niger ATCC 1015] gi|358370912|dbj|GAA87522.1| ribosomal protein of the small subunit (Rps28) [Aspergillus kawachii IFO 4308] Length = 145 Score = 107 bits (267), Expect = 3e-21 Identities = 51/57 (89%), Positives = 54/57 (94%) Frame = +3 Query: 48 MGKGKPRGLNAARKLQNTRREGRWADLNYKKRLLGTAYKSSPFGGSSHAKGIVLEKV 218 MGKG+PRGLNAARKL TRRE RWADL+YKKRLLGTAYKSSPFGG+SHAKGIVLEKV Sbjct: 1 MGKGQPRGLNAARKLATTRRENRWADLHYKKRLLGTAYKSSPFGGASHAKGIVLEKV 57