BLASTX nr result
ID: Forsythia21_contig00019183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00019183 (201 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012066479.1| PREDICTED: zinc finger A20 and AN1 domain-co... 62 2e-07 ref|XP_006851496.1| PREDICTED: zinc finger A20 and AN1 domain-co... 61 3e-07 ref|XP_010271706.1| PREDICTED: zinc finger A20 and AN1 domain-co... 61 3e-07 ref|XP_010515753.1| PREDICTED: zinc finger A20 and AN1 domain-co... 60 6e-07 ref|XP_010107862.1| Zinc finger A20 and AN1 domain-containing st... 60 7e-07 ref|XP_009366652.1| PREDICTED: zinc finger A20 and AN1 domain-co... 60 7e-07 ref|XP_008369706.1| PREDICTED: zinc finger A20 and AN1 domain-co... 60 7e-07 ref|XP_008241258.1| PREDICTED: zinc finger A20 and AN1 domain-co... 60 7e-07 ref|XP_007202639.1| hypothetical protein PRUPE_ppa012097mg [Prun... 60 7e-07 ref|XP_010943705.1| PREDICTED: zinc finger A20 and AN1 domain-co... 59 1e-06 ref|XP_009374741.1| PREDICTED: zinc finger A20 and AN1 domain-co... 59 1e-06 ref|XP_010504026.1| PREDICTED: zinc finger A20 and AN1 domain-co... 59 2e-06 ref|XP_009148741.1| PREDICTED: zinc finger A20 and AN1 domain-co... 58 2e-06 emb|CDY66222.1| BnaAnng21800D [Brassica napus] 58 2e-06 ref|XP_012072807.1| PREDICTED: zinc finger A20 and AN1 domain-co... 58 2e-06 ref|XP_007150082.1| hypothetical protein PHAVU_005G125000g [Phas... 58 2e-06 gb|EPS61935.1| hypothetical protein M569_12860, partial [Genlise... 58 2e-06 ref|NP_565844.1| zinc finger A20 and AN1 domain-containing stres... 58 2e-06 ref|XP_002879601.1| hypothetical protein ARALYDRAFT_902745 [Arab... 58 2e-06 ref|XP_012442465.1| PREDICTED: zinc finger A20 and AN1 domain-co... 58 3e-06 >ref|XP_012066479.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4-like [Jatropha curcas] gi|643736409|gb|KDP42728.1| hypothetical protein JCGZ_23668 [Jatropha curcas] Length = 159 Score = 62.0 bits (149), Expect = 2e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNSK 98 NNCGFFGSPAT NLCSKCYGD CLKE Q+ + Sbjct: 18 NNCGFFGSPATMNLCSKCYGDYCLKERQQQQQ 49 >ref|XP_006851496.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Amborella trichopoda] gi|548855190|gb|ERN13077.1| hypothetical protein AMTR_s00040p00148670 [Amborella trichopoda] Length = 183 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNS 95 NNCGFFGSPAT NLCSKCY D CLKE Q NS Sbjct: 24 NNCGFFGSPATLNLCSKCYRDFCLKEDQANS 54 >ref|XP_010271706.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Nelumbo nucifera] Length = 173 Score = 60.8 bits (146), Expect = 3e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNS 95 NNCGFFGSPAT NLCSKCY DLCLKE Q +S Sbjct: 18 NNCGFFGSPATLNLCSKCYRDLCLKEEQASS 48 >ref|XP_010515753.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Camelina sativa] gi|727467725|ref|XP_010515754.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Camelina sativa] Length = 177 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNSKSGDS 110 NNCGF GS AT NLCS CYGDLCLK+ Q++S S S Sbjct: 18 NNCGFLGSSATMNLCSNCYGDLCLKQQQQSSSSSSS 53 >ref|XP_010107862.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Morus notabilis] gi|587930133|gb|EXC17262.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Morus notabilis] Length = 105 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNS 95 NNCGFFGSPAT NLCSKCY D CLKE Q+ S Sbjct: 18 NNCGFFGSPATMNLCSKCYRDFCLKEQQQAS 48 >ref|XP_009366652.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Pyrus x bretschneideri] Length = 189 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNS 95 NNCGFFGSPAT NLCSKCY D CLKE Q+ S Sbjct: 18 NNCGFFGSPATMNLCSKCYRDFCLKEQQQAS 48 >ref|XP_008369706.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Malus domestica] gi|658020053|ref|XP_008345402.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4-like [Malus domestica] Length = 189 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNS 95 NNCGFFGSPAT NLCSKCY D CLKE Q+ S Sbjct: 18 NNCGFFGSPATMNLCSKCYRDFCLKEQQQAS 48 >ref|XP_008241258.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Prunus mume] gi|645272154|ref|XP_008241259.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Prunus mume] Length = 183 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNS 95 NNCGFFGSPAT NLCSKCY D CLKE Q+ S Sbjct: 18 NNCGFFGSPATMNLCSKCYRDFCLKEQQEAS 48 >ref|XP_007202639.1| hypothetical protein PRUPE_ppa012097mg [Prunus persica] gi|595807616|ref|XP_007202640.1| hypothetical protein PRUPE_ppa012097mg [Prunus persica] gi|462398170|gb|EMJ03838.1| hypothetical protein PRUPE_ppa012097mg [Prunus persica] gi|462398171|gb|EMJ03839.1| hypothetical protein PRUPE_ppa012097mg [Prunus persica] Length = 183 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNS 95 NNCGFFGSPAT NLCSKCY D CLKE Q+ S Sbjct: 18 NNCGFFGSPATMNLCSKCYRDFCLKEQQEAS 48 >ref|XP_010943705.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Elaeis guineensis] Length = 164 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/41 (68%), Positives = 30/41 (73%), Gaps = 4/41 (9%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNSKS----GDSP 113 NNCGFFGSPAT NLCSKCY DLCLKE + S + G SP Sbjct: 16 NNCGFFGSPATLNLCSKCYHDLCLKEEDQASSANIAVGKSP 56 >ref|XP_009374741.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4-like [Pyrus x bretschneideri] Length = 188 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNS 95 NNCGFFGSPAT NLCSKCY D C+KE Q+ S Sbjct: 18 NNCGFFGSPATMNLCSKCYRDFCIKEQQEAS 48 >ref|XP_010504026.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Camelina sativa] gi|727445011|ref|XP_010504027.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Camelina sativa] Length = 173 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNSKSGDSPL 116 NNCGF GS AT NLCS CYGDLCLK+ Q+ S S + Sbjct: 18 NNCGFLGSSATMNLCSNCYGDLCLKQQQQQQSSSSSSI 55 >ref|XP_009148741.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Brassica rapa] gi|685316258|ref|XP_009148742.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Brassica rapa] Length = 163 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNSKS 101 NNCGF GS AT NLCS CYGDLCLK+ Q+ S S Sbjct: 18 NNCGFLGSSATMNLCSNCYGDLCLKQQQQGSSS 50 >emb|CDY66222.1| BnaAnng21800D [Brassica napus] Length = 163 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNSKS 101 NNCGF GS AT NLCS CYGDLCLK+ Q+ S S Sbjct: 18 NNCGFLGSSATMNLCSNCYGDLCLKQQQQGSSS 50 >ref|XP_012072807.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 3 [Jatropha curcas] gi|643729884|gb|KDP37593.1| hypothetical protein JCGZ_07939 [Jatropha curcas] Length = 170 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNS 95 NNCGFFGSPATQNLCSKCY DL LKE Q ++ Sbjct: 15 NNCGFFGSPATQNLCSKCYRDLQLKEQQSSN 45 >ref|XP_007150082.1| hypothetical protein PHAVU_005G125000g [Phaseolus vulgaris] gi|561023346|gb|ESW22076.1| hypothetical protein PHAVU_005G125000g [Phaseolus vulgaris] Length = 156 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNS 95 NNCGFFGSPATQNLCSKCY DL LKE Q ++ Sbjct: 15 NNCGFFGSPATQNLCSKCYRDLQLKEQQSSN 45 >gb|EPS61935.1| hypothetical protein M569_12860, partial [Genlisea aurea] Length = 148 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNSKSGDSPLF 119 NNCGFFG PA +NLCSKCY DLCLK KS DSP+F Sbjct: 7 NNCGFFGVPAKKNLCSKCYTDLCLK------KSDDSPVF 39 >ref|NP_565844.1| zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Arabidopsis thaliana] gi|73921295|sp|Q9SJM6.1|SAP4_ARATH RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated protein 4; Short=AtSAP4 gi|4510345|gb|AAD21434.1| expressed protein [Arabidopsis thaliana] gi|21592464|gb|AAM64415.1| zinc finger-like protein [Arabidopsis thaliana] gi|114050557|gb|ABI49428.1| At2g36320 [Arabidopsis thaliana] gi|330254138|gb|AEC09232.1| zinc finger A20 and AN1 domain-containing stress-associated protein 4 [Arabidopsis thaliana] Length = 161 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNS 95 NNCGFFGS AT NLCS CYGDLCLK+ Q+ S Sbjct: 18 NNCGFFGSSATMNLCSNCYGDLCLKQQQQAS 48 >ref|XP_002879601.1| hypothetical protein ARALYDRAFT_902745 [Arabidopsis lyrata subsp. lyrata] gi|297325440|gb|EFH55860.1| hypothetical protein ARALYDRAFT_902745 [Arabidopsis lyrata subsp. lyrata] Length = 161 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNS 95 NNCGFFGS AT NLCS CYGDLCLK+ Q+ S Sbjct: 18 NNCGFFGSSATMNLCSNCYGDLCLKQQQQAS 48 >ref|XP_012442465.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 3 [Gossypium raimondii] gi|763788643|gb|KJB55639.1| hypothetical protein B456_009G086500 [Gossypium raimondii] Length = 162 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 3 NNCGFFGSPATQNLCSKCYGDLCLKETQKNS 95 NNCGFFGSP TQNLCSKCY DL LKE Q +S Sbjct: 15 NNCGFFGSPTTQNLCSKCYRDLQLKEQQSSS 45