BLASTX nr result
ID: Forsythia21_contig00015125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00015125 (353 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080406.1| PREDICTED: uncharacterized protein LOC105163... 77 6e-12 ref|XP_012838440.1| PREDICTED: uncharacterized protein LOC105958... 75 2e-11 >ref|XP_011080406.1| PREDICTED: uncharacterized protein LOC105163664 [Sesamum indicum] Length = 251 Score = 76.6 bits (187), Expect = 6e-12 Identities = 38/64 (59%), Positives = 44/64 (68%) Frame = -1 Query: 194 MSVADEILGQQLVNGLQCLSIQDQCQEKGTCTAAPEEINQVLSKTNNINNTTHHGLCTIC 15 MS A EI+G +LV GLQ L+I +Q K CT A EEINQ + TNNIN HHG+C IC Sbjct: 1 MSSAPEIVGLELVQGLQDLAIHEQADMKENCTEAVEEINQGVCDTNNININNHHGVCAIC 60 Query: 14 LNKI 3 LNKI Sbjct: 61 LNKI 64 >ref|XP_012838440.1| PREDICTED: uncharacterized protein LOC105958978 [Erythranthe guttatus] gi|604331086|gb|EYU35944.1| hypothetical protein MIMGU_mgv1a011982mg [Erythranthe guttata] Length = 265 Score = 74.7 bits (182), Expect = 2e-11 Identities = 37/67 (55%), Positives = 46/67 (68%), Gaps = 3/67 (4%) Frame = -1 Query: 194 MSVADEILGQQLVNGLQCLSIQDQCQEKGTCTAAPEEINQV---LSKTNNINNTTHHGLC 24 MS EI+GQ L+ LQ L+++DQ + KG CTAA EEIN+V + T N NN HHG+C Sbjct: 1 MSAPVEIIGQNLIEDLQHLTVEDQNKMKGNCTAAVEEINRVECDANDTTNNNNNNHHGIC 60 Query: 23 TICLNKI 3 ICLNKI Sbjct: 61 AICLNKI 67