BLASTX nr result
ID: Forsythia21_contig00013822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00013822 (256 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP07550.1| unnamed protein product [Coffea canephora] 157 2e-36 ref|XP_010035611.1| PREDICTED: SPX and EXS domain-containing pro... 157 3e-36 ref|XP_010035609.1| PREDICTED: SPX and EXS domain-containing pro... 157 3e-36 gb|KCW47059.1| hypothetical protein EUGRSUZ_K00863 [Eucalyptus g... 157 3e-36 ref|XP_010109539.1| SPX and EXS domain-containing protein 1 [Mor... 155 7e-36 ref|XP_008455706.1| PREDICTED: SPX and EXS domain-containing pro... 153 5e-35 ref|XP_008455704.1| PREDICTED: SPX and EXS domain-containing pro... 153 5e-35 gb|KGN54722.1| hypothetical protein Csa_4G433730 [Cucumis sativus] 152 6e-35 ref|XP_004144336.1| PREDICTED: SPX and EXS domain-containing pro... 152 6e-35 ref|XP_011083720.1| PREDICTED: SPX and EXS domain-containing pro... 151 1e-34 ref|XP_002274355.2| PREDICTED: SPX and EXS domain-containing pro... 151 2e-34 ref|XP_008230104.1| PREDICTED: SPX and EXS domain-containing pro... 150 2e-34 ref|XP_008230103.1| PREDICTED: SPX and EXS domain-containing pro... 150 2e-34 ref|XP_008230102.1| PREDICTED: SPX and EXS domain-containing pro... 150 2e-34 ref|XP_007215430.1| hypothetical protein PRUPE_ppa006141mg [Prun... 150 2e-34 ref|XP_006469721.1| PREDICTED: SPX and EXS domain-containing pro... 149 5e-34 ref|XP_006447490.1| hypothetical protein CICLE_v10015128mg [Citr... 149 5e-34 ref|XP_006447489.1| hypothetical protein CICLE_v10015128mg [Citr... 149 5e-34 ref|XP_006447488.1| hypothetical protein CICLE_v10015128mg [Citr... 149 5e-34 gb|KDO59853.1| hypothetical protein CISIN_1g014813mg [Citrus sin... 148 2e-33 >emb|CDP07550.1| unnamed protein product [Coffea canephora] Length = 520 Score = 157 bits (398), Expect = 2e-36 Identities = 72/82 (87%), Positives = 79/82 (96%) Frame = -2 Query: 252 WVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSNI 73 WVIGSNLILRCTWTYKLSAHLRHNYIT+FTITALE++RRFQWVFFRVENEWNKMNSKSNI Sbjct: 439 WVIGSNLILRCTWTYKLSAHLRHNYITVFTITALEIVRRFQWVFFRVENEWNKMNSKSNI 498 Query: 72 QLSMIDTPNEEDKLLSSNDHNV 7 +LSM + PNEE+KLL+SN HNV Sbjct: 499 ELSMSELPNEEEKLLNSNGHNV 520 >ref|XP_010035611.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X2 [Eucalyptus grandis] Length = 433 Score = 157 bits (396), Expect = 3e-36 Identities = 73/83 (87%), Positives = 78/83 (93%) Frame = -2 Query: 255 LWVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSN 76 +WVIGSNLILRCTWTYKLSAHLRHNY+TLFTITALEMLRRFQW FFRVENEWNKMNSKS Sbjct: 351 IWVIGSNLILRCTWTYKLSAHLRHNYLTLFTITALEMLRRFQWAFFRVENEWNKMNSKSG 410 Query: 75 IQLSMIDTPNEEDKLLSSNDHNV 7 IQLS I+ NEEDKLLSS+DH+V Sbjct: 411 IQLSTIEIGNEEDKLLSSSDHSV 433 >ref|XP_010035609.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X1 [Eucalyptus grandis] Length = 472 Score = 157 bits (396), Expect = 3e-36 Identities = 73/83 (87%), Positives = 78/83 (93%) Frame = -2 Query: 255 LWVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSN 76 +WVIGSNLILRCTWTYKLSAHLRHNY+TLFTITALEMLRRFQW FFRVENEWNKMNSKS Sbjct: 390 IWVIGSNLILRCTWTYKLSAHLRHNYLTLFTITALEMLRRFQWAFFRVENEWNKMNSKSG 449 Query: 75 IQLSMIDTPNEEDKLLSSNDHNV 7 IQLS I+ NEEDKLLSS+DH+V Sbjct: 450 IQLSTIEIGNEEDKLLSSSDHSV 472 >gb|KCW47059.1| hypothetical protein EUGRSUZ_K00863 [Eucalyptus grandis] Length = 483 Score = 157 bits (396), Expect = 3e-36 Identities = 73/83 (87%), Positives = 78/83 (93%) Frame = -2 Query: 255 LWVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSN 76 +WVIGSNLILRCTWTYKLSAHLRHNY+TLFTITALEMLRRFQW FFRVENEWNKMNSKS Sbjct: 401 IWVIGSNLILRCTWTYKLSAHLRHNYLTLFTITALEMLRRFQWAFFRVENEWNKMNSKSG 460 Query: 75 IQLSMIDTPNEEDKLLSSNDHNV 7 IQLS I+ NEEDKLLSS+DH+V Sbjct: 461 IQLSTIEIGNEEDKLLSSSDHSV 483 >ref|XP_010109539.1| SPX and EXS domain-containing protein 1 [Morus notabilis] gi|587936299|gb|EXC23143.1| SPX and EXS domain-containing protein 1 [Morus notabilis] Length = 404 Score = 155 bits (393), Expect = 7e-36 Identities = 72/82 (87%), Positives = 78/82 (95%) Frame = -2 Query: 252 WVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSNI 73 WV+GSNLILRCTWTYKLSAHLRHNY+TLFTITALE+ RRFQWVFFRVENE NKMNSKSNI Sbjct: 323 WVLGSNLILRCTWTYKLSAHLRHNYLTLFTITALEIFRRFQWVFFRVENELNKMNSKSNI 382 Query: 72 QLSMIDTPNEEDKLLSSNDHNV 7 QLSM +TPNEEDKLL+ N+HNV Sbjct: 383 QLSMSETPNEEDKLLAPNNHNV 404 >ref|XP_008455706.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X2 [Cucumis melo] Length = 430 Score = 153 bits (386), Expect = 5e-35 Identities = 67/83 (80%), Positives = 79/83 (95%) Frame = -2 Query: 255 LWVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSN 76 +WV+GSNLILRCTWTYKLSAHLRHNY+T+FTITALE+ RRFQW+FFRVENEWNKMNSKSN Sbjct: 348 IWVLGSNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWIFFRVENEWNKMNSKSN 407 Query: 75 IQLSMIDTPNEEDKLLSSNDHNV 7 IQ++M + P EEDKLL+S++HNV Sbjct: 408 IQITMSNLPTEEDKLLNSSNHNV 430 >ref|XP_008455704.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X1 [Cucumis melo] gi|659111349|ref|XP_008455705.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X1 [Cucumis melo] Length = 477 Score = 153 bits (386), Expect = 5e-35 Identities = 67/83 (80%), Positives = 79/83 (95%) Frame = -2 Query: 255 LWVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSN 76 +WV+GSNLILRCTWTYKLSAHLRHNY+T+FTITALE+ RRFQW+FFRVENEWNKMNSKSN Sbjct: 395 IWVLGSNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWIFFRVENEWNKMNSKSN 454 Query: 75 IQLSMIDTPNEEDKLLSSNDHNV 7 IQ++M + P EEDKLL+S++HNV Sbjct: 455 IQITMSNLPTEEDKLLNSSNHNV 477 >gb|KGN54722.1| hypothetical protein Csa_4G433730 [Cucumis sativus] Length = 456 Score = 152 bits (385), Expect = 6e-35 Identities = 67/83 (80%), Positives = 79/83 (95%) Frame = -2 Query: 255 LWVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSN 76 +WV+GSNLILRCTWTYKLSAHLRHNY+T+FTITALE+ RRFQW+FFRVENEWNKMNSKSN Sbjct: 374 VWVLGSNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWIFFRVENEWNKMNSKSN 433 Query: 75 IQLSMIDTPNEEDKLLSSNDHNV 7 IQ++M + P EEDKLL+S++HNV Sbjct: 434 IQITMSNLPTEEDKLLNSSNHNV 456 >ref|XP_004144336.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Cucumis sativus] Length = 477 Score = 152 bits (385), Expect = 6e-35 Identities = 67/83 (80%), Positives = 79/83 (95%) Frame = -2 Query: 255 LWVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSN 76 +WV+GSNLILRCTWTYKLSAHLRHNY+T+FTITALE+ RRFQW+FFRVENEWNKMNSKSN Sbjct: 395 VWVLGSNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWIFFRVENEWNKMNSKSN 454 Query: 75 IQLSMIDTPNEEDKLLSSNDHNV 7 IQ++M + P EEDKLL+S++HNV Sbjct: 455 IQITMSNLPTEEDKLLNSSNHNV 477 >ref|XP_011083720.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Sesamum indicum] Length = 472 Score = 151 bits (382), Expect = 1e-34 Identities = 71/82 (86%), Positives = 77/82 (93%) Frame = -2 Query: 252 WVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSNI 73 WVIGSNLILRCTWTYKLSAHLRHNY+T+FTITALEMLRRFQWVFFRVENEWNKMN KSNI Sbjct: 392 WVIGSNLILRCTWTYKLSAHLRHNYLTVFTITALEMLRRFQWVFFRVENEWNKMN-KSNI 450 Query: 72 QLSMIDTPNEEDKLLSSNDHNV 7 QL+M+D P EEDKLL+ N H+V Sbjct: 451 QLAMMDLPKEEDKLLNPNGHSV 472 >ref|XP_002274355.2| PREDICTED: SPX and EXS domain-containing protein 1 [Vitis vinifera] gi|731409790|ref|XP_010657324.1| PREDICTED: SPX and EXS domain-containing protein 1 [Vitis vinifera] gi|297739314|emb|CBI28965.3| unnamed protein product [Vitis vinifera] Length = 472 Score = 151 bits (381), Expect = 2e-34 Identities = 71/82 (86%), Positives = 77/82 (93%) Frame = -2 Query: 252 WVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSNI 73 WVIGSNL+LRCTWTYKLSAHLRHNY+T+FTITALE+ RRFQWVFFRVENEWNKMNSKSNI Sbjct: 392 WVIGSNLVLRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWVFFRVENEWNKMNSKSNI 451 Query: 72 QLSMIDTPNEEDKLLSSNDHNV 7 QLSM DT +EEDKLL SN+ NV Sbjct: 452 QLSMSDT-SEEDKLLGSNERNV 472 >ref|XP_008230104.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X3 [Prunus mume] Length = 441 Score = 150 bits (380), Expect = 2e-34 Identities = 69/82 (84%), Positives = 75/82 (91%) Frame = -2 Query: 252 WVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSNI 73 WVI SNLILRCTWTYKLS+HLRHNY+T+F ITALE+ RRFQWVFFRVENEWNKMNSKSNI Sbjct: 360 WVISSNLILRCTWTYKLSSHLRHNYLTVFAITALEIFRRFQWVFFRVENEWNKMNSKSNI 419 Query: 72 QLSMIDTPNEEDKLLSSNDHNV 7 QLSM DT NEE++LL SN HNV Sbjct: 420 QLSMSDTANEEERLLVSNGHNV 441 >ref|XP_008230103.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X2 [Prunus mume] Length = 464 Score = 150 bits (380), Expect = 2e-34 Identities = 69/82 (84%), Positives = 75/82 (91%) Frame = -2 Query: 252 WVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSNI 73 WVI SNLILRCTWTYKLS+HLRHNY+T+F ITALE+ RRFQWVFFRVENEWNKMNSKSNI Sbjct: 383 WVISSNLILRCTWTYKLSSHLRHNYLTVFAITALEIFRRFQWVFFRVENEWNKMNSKSNI 442 Query: 72 QLSMIDTPNEEDKLLSSNDHNV 7 QLSM DT NEE++LL SN HNV Sbjct: 443 QLSMSDTANEEERLLVSNGHNV 464 >ref|XP_008230102.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X1 [Prunus mume] Length = 473 Score = 150 bits (380), Expect = 2e-34 Identities = 69/82 (84%), Positives = 75/82 (91%) Frame = -2 Query: 252 WVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSNI 73 WVI SNLILRCTWTYKLS+HLRHNY+T+F ITALE+ RRFQWVFFRVENEWNKMNSKSNI Sbjct: 392 WVISSNLILRCTWTYKLSSHLRHNYLTVFAITALEIFRRFQWVFFRVENEWNKMNSKSNI 451 Query: 72 QLSMIDTPNEEDKLLSSNDHNV 7 QLSM DT NEE++LL SN HNV Sbjct: 452 QLSMSDTANEEERLLVSNGHNV 473 >ref|XP_007215430.1| hypothetical protein PRUPE_ppa006141mg [Prunus persica] gi|462411580|gb|EMJ16629.1| hypothetical protein PRUPE_ppa006141mg [Prunus persica] Length = 425 Score = 150 bits (380), Expect = 2e-34 Identities = 69/82 (84%), Positives = 75/82 (91%) Frame = -2 Query: 252 WVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSNI 73 WVI SNLILRCTWTYKLS+HLRHNY+T+F ITALE+ RRFQWVFFRVENEWNKMNSKSNI Sbjct: 344 WVISSNLILRCTWTYKLSSHLRHNYLTVFAITALEIFRRFQWVFFRVENEWNKMNSKSNI 403 Query: 72 QLSMIDTPNEEDKLLSSNDHNV 7 QLSM DT NEE++LL SN HNV Sbjct: 404 QLSMSDTANEEERLLVSNGHNV 425 >ref|XP_006469721.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X2 [Citrus sinensis] Length = 418 Score = 149 bits (377), Expect = 5e-34 Identities = 70/83 (84%), Positives = 73/83 (87%) Frame = -2 Query: 255 LWVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSN 76 +WVIGSNLILRCTWTYKLSAHLRHNY+T+F IT LEMLRRFQW FFRVENEWNKMNSKSN Sbjct: 336 VWVIGSNLILRCTWTYKLSAHLRHNYLTVFAITVLEMLRRFQWAFFRVENEWNKMNSKSN 395 Query: 75 IQLSMIDTPNEEDKLLSSNDHNV 7 IQLS D NEE K L SNDHNV Sbjct: 396 IQLSEKDNTNEEAKSLISNDHNV 418 >ref|XP_006447490.1| hypothetical protein CICLE_v10015128mg [Citrus clementina] gi|557550101|gb|ESR60730.1| hypothetical protein CICLE_v10015128mg [Citrus clementina] Length = 314 Score = 149 bits (377), Expect = 5e-34 Identities = 70/83 (84%), Positives = 73/83 (87%) Frame = -2 Query: 255 LWVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSN 76 +WVIGSNLILRCTWTYKLSAHLRHNY+T+F IT LEMLRRFQW FFRVENEWNKMNSKSN Sbjct: 232 VWVIGSNLILRCTWTYKLSAHLRHNYLTVFAITVLEMLRRFQWAFFRVENEWNKMNSKSN 291 Query: 75 IQLSMIDTPNEEDKLLSSNDHNV 7 IQLS D NEE K L SNDHNV Sbjct: 292 IQLSEKDNTNEEAKSLISNDHNV 314 >ref|XP_006447489.1| hypothetical protein CICLE_v10015128mg [Citrus clementina] gi|568830898|ref|XP_006469720.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X1 [Citrus sinensis] gi|557550100|gb|ESR60729.1| hypothetical protein CICLE_v10015128mg [Citrus clementina] Length = 471 Score = 149 bits (377), Expect = 5e-34 Identities = 70/83 (84%), Positives = 73/83 (87%) Frame = -2 Query: 255 LWVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSN 76 +WVIGSNLILRCTWTYKLSAHLRHNY+T+F IT LEMLRRFQW FFRVENEWNKMNSKSN Sbjct: 389 VWVIGSNLILRCTWTYKLSAHLRHNYLTVFAITVLEMLRRFQWAFFRVENEWNKMNSKSN 448 Query: 75 IQLSMIDTPNEEDKLLSSNDHNV 7 IQLS D NEE K L SNDHNV Sbjct: 449 IQLSEKDNTNEEAKSLISNDHNV 471 >ref|XP_006447488.1| hypothetical protein CICLE_v10015128mg [Citrus clementina] gi|557550099|gb|ESR60728.1| hypothetical protein CICLE_v10015128mg [Citrus clementina] Length = 437 Score = 149 bits (377), Expect = 5e-34 Identities = 70/83 (84%), Positives = 73/83 (87%) Frame = -2 Query: 255 LWVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSN 76 +WVIGSNLILRCTWTYKLSAHLRHNY+T+F IT LEMLRRFQW FFRVENEWNKMNSKSN Sbjct: 355 VWVIGSNLILRCTWTYKLSAHLRHNYLTVFAITVLEMLRRFQWAFFRVENEWNKMNSKSN 414 Query: 75 IQLSMIDTPNEEDKLLSSNDHNV 7 IQLS D NEE K L SNDHNV Sbjct: 415 IQLSEKDNTNEEAKSLISNDHNV 437 >gb|KDO59853.1| hypothetical protein CISIN_1g014813mg [Citrus sinensis] Length = 382 Score = 148 bits (373), Expect = 2e-33 Identities = 69/83 (83%), Positives = 73/83 (87%) Frame = -2 Query: 255 LWVIGSNLILRCTWTYKLSAHLRHNYITLFTITALEMLRRFQWVFFRVENEWNKMNSKSN 76 +WVIGSNLILRCTWTYKLSAHLRHNY+T+F IT LEMLRRFQW FFRVENEWNKMNSKSN Sbjct: 300 VWVIGSNLILRCTWTYKLSAHLRHNYLTVFAITVLEMLRRFQWAFFRVENEWNKMNSKSN 359 Query: 75 IQLSMIDTPNEEDKLLSSNDHNV 7 IQLS D NEE + L SNDHNV Sbjct: 360 IQLSEKDNTNEEAQSLISNDHNV 382