BLASTX nr result
ID: Forsythia21_contig00013769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00013769 (704 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077444.1| PREDICTED: uncharacterized protein LOC105161... 66 2e-08 >ref|XP_011077444.1| PREDICTED: uncharacterized protein LOC105161450 [Sesamum indicum] Length = 43 Score = 65.9 bits (159), Expect = 2e-08 Identities = 33/43 (76%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -3 Query: 483 MHSVPSNDLLM-HRPSVISSYGAWSSHRLKHLEKSDRRGNLSS 358 MHSVPS+ LL+ RP V S YG WSSHRLKHL KSDRRGNLSS Sbjct: 1 MHSVPSSHLLLLTRPHVTSFYGGWSSHRLKHLHKSDRRGNLSS 43