BLASTX nr result
ID: Forsythia21_contig00013765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00013765 (255 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072978.1| PREDICTED: putative pentatricopeptide repeat... 146 5e-33 ref|XP_009612359.1| PREDICTED: putative pentatricopeptide repeat... 145 8e-33 ref|XP_009612354.1| PREDICTED: putative pentatricopeptide repeat... 145 8e-33 ref|XP_006359301.1| PREDICTED: putative pentatricopeptide repeat... 144 3e-32 ref|XP_004237169.1| PREDICTED: putative pentatricopeptide repeat... 144 3e-32 ref|XP_009797555.1| PREDICTED: putative pentatricopeptide repeat... 142 9e-32 emb|CDP12886.1| unnamed protein product [Coffea canephora] 137 2e-30 emb|CBI29025.3| unnamed protein product [Vitis vinifera] 137 3e-30 emb|CAN71434.1| hypothetical protein VITISV_010168 [Vitis vinifera] 137 3e-30 ref|XP_012834208.1| PREDICTED: putative pentatricopeptide repeat... 137 4e-30 gb|EYU40127.1| hypothetical protein MIMGU_mgv1a019567mg [Erythra... 137 4e-30 ref|XP_010251396.1| PREDICTED: putative pentatricopeptide repeat... 127 2e-27 ref|XP_012070557.1| PREDICTED: putative pentatricopeptide repeat... 127 2e-27 gb|KDO52702.1| hypothetical protein CISIN_1g038606mg, partial [C... 127 4e-27 ref|XP_006484517.1| PREDICTED: putative pentatricopeptide repeat... 127 4e-27 ref|XP_006437612.1| hypothetical protein CICLE_v10030697mg [Citr... 126 5e-27 ref|XP_002534039.1| pentatricopeptide repeat-containing protein,... 126 6e-27 ref|XP_008394234.1| PREDICTED: putative pentatricopeptide repeat... 125 1e-26 ref|XP_008452421.1| PREDICTED: putative pentatricopeptide repeat... 123 4e-26 gb|EPS71218.1| hypothetical protein M569_03539 [Genlisea aurea] 123 5e-26 >ref|XP_011072978.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial [Sesamum indicum] Length = 792 Score = 146 bits (369), Expect = 5e-33 Identities = 66/85 (77%), Positives = 75/85 (88%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 V+LFNNLI CLSNADRL++CFDLLN+MKE+ QPTHFTFN I GCLCRR DV GAL ++R Sbjct: 479 VLLFNNLIYCLSNADRLNECFDLLNEMKETELQPTHFTFNCILGCLCRREDVVGALSLLR 538 Query: 75 EMRVHGHQPWIKYYTLLVKKLCEHG 1 EMR+ GH+PWIK YTLLVKKLCEHG Sbjct: 539 EMRICGHEPWIKNYTLLVKKLCEHG 563 >ref|XP_009612359.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial isoform X2 [Nicotiana tomentosiformis] Length = 814 Score = 145 bits (367), Expect = 8e-33 Identities = 64/85 (75%), Positives = 78/85 (91%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 V+L+NNLID LS + RLD+C++LLN+MK+S FQPTH+T+NSIFGCLCR+GD AGAL MVR Sbjct: 494 VLLYNNLIDYLSRSSRLDECYELLNEMKQSEFQPTHYTYNSIFGCLCRQGDDAGALAMVR 553 Query: 75 EMRVHGHQPWIKYYTLLVKKLCEHG 1 EMRVHGHQPWIKYYTLL++KLC+ G Sbjct: 554 EMRVHGHQPWIKYYTLLMQKLCKDG 578 >ref|XP_009612354.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial isoform X1 [Nicotiana tomentosiformis] gi|697116862|ref|XP_009612355.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial isoform X1 [Nicotiana tomentosiformis] gi|697116864|ref|XP_009612357.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial isoform X1 [Nicotiana tomentosiformis] gi|697116866|ref|XP_009612358.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial isoform X1 [Nicotiana tomentosiformis] Length = 853 Score = 145 bits (367), Expect = 8e-33 Identities = 64/85 (75%), Positives = 78/85 (91%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 V+L+NNLID LS + RLD+C++LLN+MK+S FQPTH+T+NSIFGCLCR+GD AGAL MVR Sbjct: 494 VLLYNNLIDYLSRSSRLDECYELLNEMKQSEFQPTHYTYNSIFGCLCRQGDDAGALAMVR 553 Query: 75 EMRVHGHQPWIKYYTLLVKKLCEHG 1 EMRVHGHQPWIKYYTLL++KLC+ G Sbjct: 554 EMRVHGHQPWIKYYTLLMQKLCKDG 578 >ref|XP_006359301.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565387018|ref|XP_006359302.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565387020|ref|XP_006359303.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 852 Score = 144 bits (362), Expect = 3e-32 Identities = 63/85 (74%), Positives = 78/85 (91%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 V+L+NNLID LS A RL++C++LL++MK+SGF PTH+T+NSIFGCLCR+GD AGAL +VR Sbjct: 493 VLLYNNLIDSLSRASRLNECYELLDEMKQSGFLPTHYTYNSIFGCLCRQGDDAGALAVVR 552 Query: 75 EMRVHGHQPWIKYYTLLVKKLCEHG 1 EMRVHGHQPWIKYYTLL+KKLC+ G Sbjct: 553 EMRVHGHQPWIKYYTLLMKKLCKDG 577 >ref|XP_004237169.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial [Solanum lycopersicum] gi|723689789|ref|XP_010319319.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial [Solanum lycopersicum] gi|723689795|ref|XP_010319320.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial [Solanum lycopersicum] gi|723689798|ref|XP_010319321.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial [Solanum lycopersicum] gi|723689801|ref|XP_010319322.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial [Solanum lycopersicum] Length = 852 Score = 144 bits (362), Expect = 3e-32 Identities = 64/85 (75%), Positives = 77/85 (90%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 V+L+NNLID LS A RL++C+ LL++MK+S FQPTH+T+NSIFGCLCR+GD AGAL MVR Sbjct: 493 VLLYNNLIDSLSRASRLNECYKLLDEMKQSEFQPTHYTYNSIFGCLCRQGDDAGALAMVR 552 Query: 75 EMRVHGHQPWIKYYTLLVKKLCEHG 1 EMRVHGHQPWIKYYTLL+KKLC+ G Sbjct: 553 EMRVHGHQPWIKYYTLLMKKLCKDG 577 >ref|XP_009797555.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial [Nicotiana sylvestris] gi|698504001|ref|XP_009797556.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial [Nicotiana sylvestris] Length = 853 Score = 142 bits (358), Expect = 9e-32 Identities = 62/85 (72%), Positives = 78/85 (91%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 V+L+NNLID LS + RLD+C++LLN+MK+S F+PTH+T+NSIFGCLCR+GD AGAL +VR Sbjct: 494 VLLYNNLIDYLSRSARLDECYELLNEMKQSEFRPTHYTYNSIFGCLCRQGDDAGALALVR 553 Query: 75 EMRVHGHQPWIKYYTLLVKKLCEHG 1 EMRVHGHQPWIKYYTLL++KLC+ G Sbjct: 554 EMRVHGHQPWIKYYTLLMQKLCKDG 578 >emb|CDP12886.1| unnamed protein product [Coffea canephora] Length = 819 Score = 137 bits (346), Expect = 2e-30 Identities = 61/85 (71%), Positives = 75/85 (88%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 VIL+NN+ID LSNADRL +C++LL +MKE GFQPTHFT+NSIFGCLCR+ +V GAL +VR Sbjct: 464 VILYNNMIDFLSNADRLTECYELLIEMKEFGFQPTHFTYNSIFGCLCRQMNVTGALHLVR 523 Query: 75 EMRVHGHQPWIKYYTLLVKKLCEHG 1 +MR GH+PWIK YTLL+KKLC+HG Sbjct: 524 DMRACGHEPWIKNYTLLIKKLCKHG 548 >emb|CBI29025.3| unnamed protein product [Vitis vinifera] Length = 854 Score = 137 bits (345), Expect = 3e-30 Identities = 62/83 (74%), Positives = 75/83 (90%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 V+L+NNLID LSN++RL++C+ LL +MK SGF+PT FT NSIFGCLCRR DV GALDMVR Sbjct: 492 VLLYNNLIDKLSNSNRLEECYLLLKEMKGSGFRPTQFTHNSIFGCLCRREDVTGALDMVR 551 Query: 75 EMRVHGHQPWIKYYTLLVKKLCE 7 EMRVHGH+PWIK+YTLLVK+LC+ Sbjct: 552 EMRVHGHEPWIKHYTLLVKQLCK 574 >emb|CAN71434.1| hypothetical protein VITISV_010168 [Vitis vinifera] Length = 814 Score = 137 bits (345), Expect = 3e-30 Identities = 62/83 (74%), Positives = 75/83 (90%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 V+L+NNLID LSN++RL++C+ LL +MK SGF+PT FT NSIFGCLCRR DV GALDMVR Sbjct: 452 VLLYNNLIDKLSNSNRLEECYLLLKEMKGSGFRPTQFTHNSIFGCLCRREDVTGALDMVR 511 Query: 75 EMRVHGHQPWIKYYTLLVKKLCE 7 EMRVHGH+PWIK+YTLLVK+LC+ Sbjct: 512 EMRVHGHEPWIKHYTLLVKQLCK 534 >ref|XP_012834208.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial [Erythranthe guttatus] Length = 792 Score = 137 bits (344), Expect = 4e-30 Identities = 62/85 (72%), Positives = 73/85 (85%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 V+LFNNLI LSNADRLD+CF LLN+MKE+ F+PTHFTFN I GCLCR+ ++ +LD++R Sbjct: 479 VLLFNNLIHFLSNADRLDECFVLLNEMKETEFRPTHFTFNCILGCLCRQENITRSLDLIR 538 Query: 75 EMRVHGHQPWIKYYTLLVKKLCEHG 1 EMRV GH PWIK YTLLVKKLCEHG Sbjct: 539 EMRVSGHVPWIKNYTLLVKKLCEHG 563 >gb|EYU40127.1| hypothetical protein MIMGU_mgv1a019567mg [Erythranthe guttata] Length = 768 Score = 137 bits (344), Expect = 4e-30 Identities = 62/85 (72%), Positives = 73/85 (85%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 V+LFNNLI LSNADRLD+CF LLN+MKE+ F+PTHFTFN I GCLCR+ ++ +LD++R Sbjct: 455 VLLFNNLIHFLSNADRLDECFVLLNEMKETEFRPTHFTFNCILGCLCRQENITRSLDLIR 514 Query: 75 EMRVHGHQPWIKYYTLLVKKLCEHG 1 EMRV GH PWIK YTLLVKKLCEHG Sbjct: 515 EMRVSGHVPWIKNYTLLVKKLCEHG 539 >ref|XP_010251396.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial [Nelumbo nucifera] gi|719985466|ref|XP_010251397.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial [Nelumbo nucifera] Length = 869 Score = 127 bits (320), Expect = 2e-27 Identities = 57/85 (67%), Positives = 74/85 (87%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 V+L+NNLI+ L NA+R+D+ F+LL +MK+SGF+PT FT NSIFGC CRR DV+ A+D+VR Sbjct: 501 VLLYNNLINELCNANRVDEGFELLKEMKKSGFKPTQFTHNSIFGCFCRREDVSRAIDLVR 560 Query: 75 EMRVHGHQPWIKYYTLLVKKLCEHG 1 EMR +GH+PWIKYY+LLVK+LC HG Sbjct: 561 EMRENGHEPWIKYYSLLVKQLCIHG 585 >ref|XP_012070557.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial [Jatropha curcas] gi|643740706|gb|KDP46296.1| hypothetical protein JCGZ_10136 [Jatropha curcas] Length = 836 Score = 127 bits (320), Expect = 2e-27 Identities = 52/85 (61%), Positives = 76/85 (89%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 ++++NNLID L N++RL++ ++LL +M+ESGF+PT FT NSIFGCLCRRGDV+GALD+V+ Sbjct: 469 LLIYNNLIDELCNSNRLEESYELLREMEESGFEPTEFTHNSIFGCLCRRGDVSGALDLVK 528 Query: 75 EMRVHGHQPWIKYYTLLVKKLCEHG 1 +MR HG +PW+K+YTLLV+ +C++G Sbjct: 529 KMRFHGQEPWVKHYTLLVRNMCKNG 553 >gb|KDO52702.1| hypothetical protein CISIN_1g038606mg, partial [Citrus sinensis] Length = 666 Score = 127 bits (318), Expect = 4e-27 Identities = 54/85 (63%), Positives = 74/85 (87%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 V L+NNLID L N++RL++ ++LL +M+ESGF+PTHFT NS+F CLCRR DV GAL++VR Sbjct: 359 VFLYNNLIDGLCNSNRLEESYELLREMEESGFKPTHFTLNSMFRCLCRRQDVVGALNLVR 418 Query: 75 EMRVHGHQPWIKYYTLLVKKLCEHG 1 +MRV GH+PW+K+ TLL+K+LC+HG Sbjct: 419 KMRVQGHEPWVKHNTLLIKELCKHG 443 >ref|XP_006484517.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial-like [Citrus sinensis] Length = 845 Score = 127 bits (318), Expect = 4e-27 Identities = 54/85 (63%), Positives = 74/85 (87%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 V L+NNLID L N++RL++ ++LL +M+ESGF+PTHFT NS+F CLCRR DV GAL++VR Sbjct: 474 VFLYNNLIDGLCNSNRLEESYELLREMEESGFKPTHFTLNSMFRCLCRRQDVVGALNLVR 533 Query: 75 EMRVHGHQPWIKYYTLLVKKLCEHG 1 +MRV GH+PW+K+ TLL+K+LC+HG Sbjct: 534 KMRVQGHEPWVKHNTLLIKELCKHG 558 >ref|XP_006437612.1| hypothetical protein CICLE_v10030697mg [Citrus clementina] gi|557539808|gb|ESR50852.1| hypothetical protein CICLE_v10030697mg [Citrus clementina] Length = 845 Score = 126 bits (317), Expect = 5e-27 Identities = 54/85 (63%), Positives = 74/85 (87%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 V L+NNLID L N++RL++ ++LL +M+ESGF+PTHFT NS+F CLCRR DV GAL++VR Sbjct: 474 VFLYNNLIDGLCNSNRLEESYELLREMEESGFKPTHFTLNSMFCCLCRRQDVVGALNLVR 533 Query: 75 EMRVHGHQPWIKYYTLLVKKLCEHG 1 +MRV GH+PW+K+ TLL+K+LC+HG Sbjct: 534 KMRVQGHEPWVKHNTLLIKELCKHG 558 >ref|XP_002534039.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223525946|gb|EEF28343.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 634 Score = 126 bits (316), Expect = 6e-27 Identities = 53/85 (62%), Positives = 76/85 (89%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 ++L+NNLI+ L N+DRL++ + LL +M+ESGF+PT FT NSIFGCLC+R DV+GALD+V+ Sbjct: 266 LLLYNNLINGLCNSDRLEESYKLLKEMEESGFKPTQFTLNSIFGCLCKRQDVSGALDLVK 325 Query: 75 EMRVHGHQPWIKYYTLLVKKLCEHG 1 +MR++G +PW+K+YTLLV+KLC+HG Sbjct: 326 KMRLYGCEPWVKHYTLLVRKLCKHG 350 >ref|XP_008394234.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial [Malus domestica] Length = 778 Score = 125 bits (314), Expect = 1e-26 Identities = 55/84 (65%), Positives = 70/84 (83%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 V ++NNLID L N+DRLD+ + LL +M++SG +PTHFT NSIFGCLCRR DV AL++V+ Sbjct: 479 VSIYNNLIDALCNSDRLDESYKLLREMEQSGLEPTHFTHNSIFGCLCRRQDVVAALNLVK 538 Query: 75 EMRVHGHQPWIKYYTLLVKKLCEH 4 EMR GH+PWIKY TLLVK+LC+H Sbjct: 539 EMRACGHEPWIKYSTLLVKQLCKH 562 >ref|XP_008452421.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial [Cucumis melo] Length = 880 Score = 123 bits (309), Expect = 4e-26 Identities = 51/84 (60%), Positives = 71/84 (84%) Frame = -1 Query: 252 ILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVRE 73 +L+NN+ID L +DRL++ + LL M++S QPTHFT+NSIFGCLCRR D GA++++RE Sbjct: 522 LLYNNMIDALCKSDRLEESYKLLRDMEQSRLQPTHFTYNSIFGCLCRREDTVGAIELLRE 581 Query: 72 MRVHGHQPWIKYYTLLVKKLCEHG 1 MRVHGH+PW+K+ TLLVK+LC++G Sbjct: 582 MRVHGHEPWLKHSTLLVKQLCKNG 605 >gb|EPS71218.1| hypothetical protein M569_03539 [Genlisea aurea] Length = 796 Score = 123 bits (308), Expect = 5e-26 Identities = 55/85 (64%), Positives = 66/85 (77%) Frame = -1 Query: 255 VILFNNLIDCLSNADRLDDCFDLLNKMKESGFQPTHFTFNSIFGCLCRRGDVAGALDMVR 76 V LFN++I+CLS DRL CFDLL +MK++ QPTHFTFN I GCLCRR DVAG+L ++R Sbjct: 477 VSLFNDVINCLSKGDRLIVCFDLLTQMKQANLQPTHFTFNCILGCLCRRADVAGSLAVIR 536 Query: 75 EMRVHGHQPWIKYYTLLVKKLCEHG 1 EMR HG +PWIK Y LVK+LC G Sbjct: 537 EMRCHGFEPWIKNYVTLVKQLCREG 561