BLASTX nr result
ID: Forsythia21_contig00013680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00013680 (252 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009790410.1| PREDICTED: oligopeptide transporter 4 [Nicot... 59 2e-06 ref|XP_006417516.1| hypothetical protein EUTSA_v10009349mg [Eutr... 58 3e-06 gb|KMT00940.1| hypothetical protein BVRB_9g222060 isoform A [Bet... 57 5e-06 ref|XP_010691453.1| PREDICTED: oligopeptide transporter 4 [Beta ... 57 5e-06 ref|XP_010475851.1| PREDICTED: oligopeptide transporter 2-like [... 57 5e-06 ref|XP_010458316.1| PREDICTED: oligopeptide transporter 2-like [... 57 5e-06 ref|XP_010501399.1| PREDICTED: oligopeptide transporter 2 [Camel... 57 5e-06 ref|XP_006304646.1| hypothetical protein CARUB_v10011782mg [Caps... 57 5e-06 ref|XP_002892535.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata] gi... 57 5e-06 ref|XP_012068073.1| PREDICTED: oligopeptide transporter 4-like [... 57 6e-06 ref|XP_010029956.1| PREDICTED: oligopeptide transporter 4-like [... 57 6e-06 emb|CDO97358.1| unnamed protein product [Coffea canephora] 57 6e-06 gb|KCW56912.1| hypothetical protein EUGRSUZ_I02589 [Eucalyptus g... 57 6e-06 gb|EPS61159.1| oligopeptide transporter 2, partial [Genlisea aurea] 57 6e-06 ref|XP_010029951.1| PREDICTED: oligopeptide transporter 4-like [... 56 8e-06 >ref|XP_009790410.1| PREDICTED: oligopeptide transporter 4 [Nicotiana sylvestris] Length = 738 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 159 GFIDEEDESPIEEVRLTVSNSDDPTLPVWTF 251 G D++DESPIEEVRLTV+N+DDPTLPVWTF Sbjct: 14 GAADDDDESPIEEVRLTVTNTDDPTLPVWTF 44 >ref|XP_006417516.1| hypothetical protein EUTSA_v10009349mg [Eutrema salsugineum] gi|557095287|gb|ESQ35869.1| hypothetical protein EUTSA_v10009349mg [Eutrema salsugineum] Length = 731 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +3 Query: 165 IDEEDESPIEEVRLTVSNSDDPTLPVWTF 251 +D+EDESP+EEVRLTVSN DDP+LPVWTF Sbjct: 11 MDDEDESPVEEVRLTVSNDDDPSLPVWTF 39 >gb|KMT00940.1| hypothetical protein BVRB_9g222060 isoform A [Beta vulgaris subsp. vulgaris] Length = 213 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 165 IDEEDESPIEEVRLTVSNSDDPTLPVWTF 251 IDE+D SPIEEVRLTV+N+DDPTLPVWTF Sbjct: 21 IDEDDISPIEEVRLTVTNTDDPTLPVWTF 49 >ref|XP_010691453.1| PREDICTED: oligopeptide transporter 4 [Beta vulgaris subsp. vulgaris] gi|870848652|gb|KMT00941.1| hypothetical protein BVRB_9g222060 isoform B [Beta vulgaris subsp. vulgaris] Length = 746 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 165 IDEEDESPIEEVRLTVSNSDDPTLPVWTF 251 IDE+D SPIEEVRLTV+N+DDPTLPVWTF Sbjct: 21 IDEDDISPIEEVRLTVTNTDDPTLPVWTF 49 >ref|XP_010475851.1| PREDICTED: oligopeptide transporter 2-like [Camelina sativa] Length = 735 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +3 Query: 168 DEEDESPIEEVRLTVSNSDDPTLPVWTF 251 D+EDESP+EEVRLTVSN DDP+LPVWTF Sbjct: 16 DDEDESPVEEVRLTVSNHDDPSLPVWTF 43 >ref|XP_010458316.1| PREDICTED: oligopeptide transporter 2-like [Camelina sativa] Length = 736 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +3 Query: 168 DEEDESPIEEVRLTVSNSDDPTLPVWTF 251 D+EDESP+EEVRLTVSN DDP+LPVWTF Sbjct: 17 DDEDESPVEEVRLTVSNHDDPSLPVWTF 44 >ref|XP_010501399.1| PREDICTED: oligopeptide transporter 2 [Camelina sativa] Length = 735 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +3 Query: 168 DEEDESPIEEVRLTVSNSDDPTLPVWTF 251 D+EDESP+EEVRLTVSN DDP+LPVWTF Sbjct: 16 DDEDESPVEEVRLTVSNHDDPSLPVWTF 43 >ref|XP_006304646.1| hypothetical protein CARUB_v10011782mg [Capsella rubella] gi|482573357|gb|EOA37544.1| hypothetical protein CARUB_v10011782mg [Capsella rubella] Length = 735 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +3 Query: 168 DEEDESPIEEVRLTVSNSDDPTLPVWTF 251 D+EDESP+EEVRLTVSN DDP+LPVWTF Sbjct: 16 DDEDESPVEEVRLTVSNHDDPSLPVWTF 43 >ref|XP_002892535.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata] gi|297338377|gb|EFH68794.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata] Length = 734 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +3 Query: 168 DEEDESPIEEVRLTVSNSDDPTLPVWTF 251 D+EDESP+EEVRLTVSN DDP+LPVWTF Sbjct: 15 DDEDESPVEEVRLTVSNHDDPSLPVWTF 42 >ref|XP_012068073.1| PREDICTED: oligopeptide transporter 4-like [Jatropha curcas] Length = 750 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 156 HGFIDEEDESPIEEVRLTVSNSDDPTLPVWTF 251 +G I+EE+ SPIEEVRLTV N+DDPTLPVWTF Sbjct: 17 YGEIEEEEVSPIEEVRLTVPNTDDPTLPVWTF 48 >ref|XP_010029956.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis] Length = 743 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +3 Query: 165 IDEEDESPIEEVRLTVSNSDDPTLPVWTF 251 +DE+D SPIEEVRLTV+N+DDPTLPVWTF Sbjct: 21 VDEDDLSPIEEVRLTVTNTDDPTLPVWTF 49 >emb|CDO97358.1| unnamed protein product [Coffea canephora] Length = 309 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 156 HGFIDEEDESPIEEVRLTVSNSDDPTLPVWTF 251 H ++ED+SPIEEVRLTVSN DDPTLPVWTF Sbjct: 20 HQKYEDEDDSPIEEVRLTVSNYDDPTLPVWTF 51 >gb|KCW56912.1| hypothetical protein EUGRSUZ_I02589 [Eucalyptus grandis] Length = 770 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +3 Query: 165 IDEEDESPIEEVRLTVSNSDDPTLPVWTF 251 +DE+D SPIEEVRLTV+N+DDPTLPVWTF Sbjct: 48 VDEDDLSPIEEVRLTVTNTDDPTLPVWTF 76 >gb|EPS61159.1| oligopeptide transporter 2, partial [Genlisea aurea] Length = 77 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +3 Query: 168 DEEDESPIEEVRLTVSNSDDPTLPVWTF 251 D +DESP+E+VRLTVSNSDDPTLPVWTF Sbjct: 12 DYDDESPVEQVRLTVSNSDDPTLPVWTF 39 >ref|XP_010029951.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis] gi|629090656|gb|KCW56909.1| hypothetical protein EUGRSUZ_I02585 [Eucalyptus grandis] Length = 746 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 159 GFIDEEDESPIEEVRLTVSNSDDPTLPVWTF 251 G +D++D SPIEEVRLTVSN+DDP+LPVWTF Sbjct: 22 GTVDKDDLSPIEEVRLTVSNADDPSLPVWTF 52