BLASTX nr result
ID: Forsythia21_contig00013605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00013605 (341 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004491390.1| PREDICTED: 40S ribosomal protein S29 [Cicer ... 129 1e-27 ref|XP_012836861.1| PREDICTED: 40S ribosomal protein S29 [Erythr... 128 2e-27 gb|ABK93131.1| unknown [Populus trichocarpa] 128 2e-27 ref|XP_011078121.1| PREDICTED: 40S ribosomal protein S29 [Sesamu... 127 3e-27 gb|KCW68667.1| hypothetical protein EUGRSUZ_F02264, partial [Euc... 127 3e-27 ref|XP_002263938.1| PREDICTED: 40S ribosomal protein S29 [Vitis ... 127 3e-27 ref|XP_002271801.1| PREDICTED: 40S ribosomal protein S29-like [V... 127 4e-27 ref|XP_012848151.1| PREDICTED: 40S ribosomal protein S29-like [E... 127 4e-27 gb|ABK93425.1| unknown [Populus trichocarpa] 127 4e-27 gb|KHG00104.1| 40S ribosomal S29 -like protein [Gossypium arboreum] 125 8e-27 ref|XP_010061691.1| PREDICTED: 40S ribosomal protein S29 [Eucaly... 125 1e-26 ref|XP_007042613.1| Ribosomal protein S14p/S29e family protein [... 125 1e-26 ref|XP_010272246.1| PREDICTED: 40S ribosomal protein S29 [Nelumb... 125 1e-26 gb|KGN43857.1| hypothetical protein Csa_7G071460 [Cucumis sativus] 125 1e-26 ref|XP_009393841.1| PREDICTED: 40S ribosomal protein S29 [Musa a... 125 1e-26 ref|XP_006474714.1| PREDICTED: 40S ribosomal protein S29-like [C... 125 1e-26 ref|XP_002320698.2| hypothetical protein POPTR_0014s01800g [Popu... 125 1e-26 ref|NP_001294917.1| uncharacterized protein LOC544138 [Solanum l... 124 2e-26 ref|XP_007223556.1| hypothetical protein PRUPE_ppa014535mg [Prun... 124 2e-26 ref|XP_010679081.1| PREDICTED: 40S ribosomal protein S29 [Beta v... 124 2e-26 >ref|XP_004491390.1| PREDICTED: 40S ribosomal protein S29 [Cicer arietinum] gi|502158873|ref|XP_004511309.1| PREDICTED: 40S ribosomal protein S29 [Cicer arietinum] gi|828305776|ref|XP_012570209.1| PREDICTED: 40S ribosomal protein S29 [Cicer arietinum] Length = 56 Score = 129 bits (323), Expect = 1e-27 Identities = 53/56 (94%), Positives = 56/56 (100%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 MGHSN+WNSHPKTYGPGSRTCRVCGNPHG+IRKYG+MCCRQCFRSNAKEIGFIKYR Sbjct: 1 MGHSNVWNSHPKTYGPGSRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_012836861.1| PREDICTED: 40S ribosomal protein S29 [Erythranthe guttatus] Length = 56 Score = 128 bits (321), Expect = 2e-27 Identities = 53/56 (94%), Positives = 56/56 (100%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 MGHSNIWNSHPKTYGPGSRTCRVCGNPHG+IRKYG+MCCRQCFRSN+KEIGFIKYR Sbjct: 1 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGLIRKYGLMCCRQCFRSNSKEIGFIKYR 56 >gb|ABK93131.1| unknown [Populus trichocarpa] Length = 56 Score = 128 bits (321), Expect = 2e-27 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 MGHSNIWNSHPK YGPGSRTCRVCGNPHGIIRKYG+MCCRQCFRSNAKEIGFIKYR Sbjct: 1 MGHSNIWNSHPKNYGPGSRTCRVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_011078121.1| PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] gi|747081556|ref|XP_011088056.1| PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] gi|747089732|ref|XP_011092516.1| PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] gi|747092208|ref|XP_011093855.1| PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] Length = 56 Score = 127 bits (319), Expect = 3e-27 Identities = 53/56 (94%), Positives = 55/56 (98%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 MGHSNIWNSHPK YGPGSRTCRVCGNPHG+IRKYG+MCCRQCFRSNAKEIGFIKYR Sbjct: 1 MGHSNIWNSHPKNYGPGSRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >gb|KCW68667.1| hypothetical protein EUGRSUZ_F02264, partial [Eucalyptus grandis] Length = 83 Score = 127 bits (319), Expect = 3e-27 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = -1 Query: 257 KMGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 KMGHSN+WNSHPK+YGPGSR CRVCGNPHG+IRKYG+MCCRQCFRSNAKEIGFIKYR Sbjct: 27 KMGHSNVWNSHPKSYGPGSRACRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 83 >ref|XP_002263938.1| PREDICTED: 40S ribosomal protein S29 [Vitis vinifera] gi|470106904|ref|XP_004289795.1| PREDICTED: 40S ribosomal protein S29 [Fragaria vesca subsp. vesca] gi|470109340|ref|XP_004290957.1| PREDICTED: 40S ribosomal protein S29 [Fragaria vesca subsp. vesca] gi|593640056|ref|XP_007143103.1| hypothetical protein PHAVU_007G043800g [Phaseolus vulgaris] gi|561016293|gb|ESW15097.1| hypothetical protein PHAVU_007G043800g [Phaseolus vulgaris] Length = 56 Score = 127 bits (319), Expect = 3e-27 Identities = 52/56 (92%), Positives = 56/56 (100%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 MGHSN+WNSHPK+YGPGSRTCRVCGNPHG+IRKYG+MCCRQCFRSNAKEIGFIKYR Sbjct: 1 MGHSNVWNSHPKSYGPGSRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_002271801.1| PREDICTED: 40S ribosomal protein S29-like [Vitis vinifera] gi|225444692|ref|XP_002277856.1| PREDICTED: 40S ribosomal protein S29 [Vitis vinifera] gi|255538096|ref|XP_002510113.1| 40S ribosomal protein S29, putative [Ricinus communis] gi|356497504|ref|XP_003517600.1| PREDICTED: 40S ribosomal protein S29-like [Glycine max] gi|356536119|ref|XP_003536587.1| PREDICTED: 40S ribosomal protein S29 [Glycine max] gi|356538933|ref|XP_003537955.1| PREDICTED: 40S ribosomal protein S29-like isoform 1 [Glycine max] gi|356575720|ref|XP_003555985.1| PREDICTED: 40S ribosomal protein S29-like [Glycine max] gi|449438331|ref|XP_004136942.1| PREDICTED: 40S ribosomal protein S29 [Cucumis sativus] gi|449447053|ref|XP_004141284.1| PREDICTED: 40S ribosomal protein S29 [Cucumis sativus] gi|449469128|ref|XP_004152273.1| PREDICTED: 40S ribosomal protein S29 [Cucumis sativus] gi|645261744|ref|XP_008236441.1| PREDICTED: 40S ribosomal protein S29 [Prunus mume] gi|657962892|ref|XP_008373047.1| PREDICTED: 40S ribosomal protein S29 [Malus domestica] gi|658061279|ref|XP_008366503.1| PREDICTED: 40S ribosomal protein S29 [Malus domestica] gi|659103501|ref|XP_008452633.1| PREDICTED: 40S ribosomal protein S29 [Cucumis melo] gi|659108782|ref|XP_008454386.1| PREDICTED: 40S ribosomal protein S29 [Cucumis melo] gi|659110059|ref|XP_008455027.1| PREDICTED: 40S ribosomal protein S29 [Cucumis melo] gi|694414331|ref|XP_009335389.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] gi|694414333|ref|XP_009335391.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] gi|694414343|ref|XP_009335395.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] gi|694414345|ref|XP_009335396.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] gi|802570598|ref|XP_012068241.1| PREDICTED: 40S ribosomal protein S29-like [Jatropha curcas] gi|223550814|gb|EEF52300.1| 40S ribosomal protein S29, putative [Ricinus communis] gi|700200099|gb|KGN55257.1| 40S ribosomal protein S29 [Cucumis sativus] gi|734330582|gb|KHN06796.1| 40S ribosomal protein S29 [Glycine soja] gi|734423705|gb|KHN42324.1| 40S ribosomal protein S29 [Glycine soja] Length = 56 Score = 127 bits (318), Expect = 4e-27 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 MGHSN+WNSHPK YGPGSRTCRVCGNPHG+IRKYG+MCCRQCFRSNAKEIGFIKYR Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_012848151.1| PREDICTED: 40S ribosomal protein S29-like [Erythranthe guttatus] gi|848902651|ref|XP_012851231.1| PREDICTED: 40S ribosomal protein S29-like [Erythranthe guttatus] gi|604311845|gb|EYU25839.1| hypothetical protein MIMGU_mgv1a017601mg [Erythranthe guttata] Length = 56 Score = 127 bits (318), Expect = 4e-27 Identities = 52/56 (92%), Positives = 56/56 (100%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 MGH+NIWNSHPKTYGPGSRTCRVCGNPHG+IRKYG+MCCRQCFRSN+KEIGFIKYR Sbjct: 1 MGHANIWNSHPKTYGPGSRTCRVCGNPHGLIRKYGLMCCRQCFRSNSKEIGFIKYR 56 >gb|ABK93425.1| unknown [Populus trichocarpa] Length = 56 Score = 127 bits (318), Expect = 4e-27 Identities = 53/56 (94%), Positives = 55/56 (98%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 MGHSNIWNSHP+ YGPGSRTCRVCGNPHGIIRKYG+MCCRQCFRSNAKEIGFIKYR Sbjct: 1 MGHSNIWNSHPRNYGPGSRTCRVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >gb|KHG00104.1| 40S ribosomal S29 -like protein [Gossypium arboreum] Length = 56 Score = 125 bits (315), Expect = 8e-27 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 MGHSNIWNSHPKTYGPGSR CRVCGNPH IIRKYG+MCCRQCFRSNAKEIGFIKYR Sbjct: 1 MGHSNIWNSHPKTYGPGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_010061691.1| PREDICTED: 40S ribosomal protein S29 [Eucalyptus grandis] gi|702462264|ref|XP_010028373.1| PREDICTED: 40S ribosomal protein S29 [Eucalyptus grandis] Length = 56 Score = 125 bits (314), Expect = 1e-26 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 MGHSN+WNSHPK+YGPGSR CRVCGNPHG+IRKYG+MCCRQCFRSNAKEIGFIKYR Sbjct: 1 MGHSNVWNSHPKSYGPGSRACRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_007042613.1| Ribosomal protein S14p/S29e family protein [Theobroma cacao] gi|823129887|ref|XP_012450812.1| PREDICTED: 40S ribosomal protein S29 [Gossypium raimondii] gi|823160635|ref|XP_012480164.1| PREDICTED: 40S ribosomal protein S29 [Gossypium raimondii] gi|823203386|ref|XP_012436123.1| PREDICTED: 40S ribosomal protein S29 [Gossypium raimondii] gi|823256378|ref|XP_012460836.1| PREDICTED: 40S ribosomal protein S29 [Gossypium raimondii] gi|823264940|ref|XP_012465209.1| PREDICTED: 40S ribosomal protein S29 [Gossypium raimondii] gi|388494112|gb|AFK35122.1| unknown [Lotus japonicus] gi|508706548|gb|EOX98444.1| Ribosomal protein S14p/S29e family protein [Theobroma cacao] gi|728828321|gb|KHG07764.1| 40S ribosomal S29 -like protein [Gossypium arboreum] gi|763744849|gb|KJB12288.1| hypothetical protein B456_002G010100 [Gossypium raimondii] gi|763765019|gb|KJB32273.1| hypothetical protein B456_005G232700 [Gossypium raimondii] gi|763810737|gb|KJB77639.1| hypothetical protein B456_012G148100 [Gossypium raimondii] gi|763812584|gb|KJB79436.1| hypothetical protein B456_013G049700 [Gossypium raimondii] Length = 56 Score = 125 bits (314), Expect = 1e-26 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 MGHSN+WNSHPKTYGPGSR CRVCGNPH IIRKYG+MCCRQCFRSNAKEIGFIKYR Sbjct: 1 MGHSNVWNSHPKTYGPGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_010272246.1| PREDICTED: 40S ribosomal protein S29 [Nelumbo nucifera] gi|720018519|ref|XP_010261813.1| PREDICTED: 40S ribosomal protein S29 [Nelumbo nucifera] gi|720068354|ref|XP_010277082.1| PREDICTED: 40S ribosomal protein S29 [Nelumbo nucifera] gi|802550661|ref|XP_012093101.1| PREDICTED: 40S ribosomal protein S29 [Jatropha curcas] Length = 56 Score = 125 bits (313), Expect = 1e-26 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 MGHSN+WNSHPK YGPGSR CRVCGNPHG+IRKYG+MCCRQCFRSNAKEIGFIKYR Sbjct: 1 MGHSNVWNSHPKNYGPGSRACRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >gb|KGN43857.1| hypothetical protein Csa_7G071460 [Cucumis sativus] Length = 109 Score = 125 bits (313), Expect = 1e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKY 90 MGHSN+WNSHPK YGPGSRTCRVCGNPHG+IRKYG+MCCRQCFRSNAKEIGFIKY Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKY 55 >ref|XP_009393841.1| PREDICTED: 40S ribosomal protein S29 [Musa acuminata subsp. malaccensis] gi|695034633|ref|XP_009404780.1| PREDICTED: 40S ribosomal protein S29 [Musa acuminata subsp. malaccensis] gi|695065043|ref|XP_009421099.1| PREDICTED: 40S ribosomal protein S29 [Musa acuminata subsp. malaccensis] gi|695078263|ref|XP_009386513.1| PREDICTED: 40S ribosomal protein S29 [Musa acuminata subsp. malaccensis] Length = 56 Score = 125 bits (313), Expect = 1e-26 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 MGHSN+WNSHPK YGPGSR CRVCGNPHG+IRKYG+MCCRQCFRSNAKEIGFIKYR Sbjct: 1 MGHSNVWNSHPKNYGPGSRVCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_006474714.1| PREDICTED: 40S ribosomal protein S29-like [Citrus sinensis] gi|568867204|ref|XP_006486933.1| PREDICTED: 40S ribosomal protein S29-like [Citrus sinensis] gi|641855086|gb|KDO73880.1| hypothetical protein CISIN_1g037282mg [Citrus sinensis] Length = 56 Score = 125 bits (313), Expect = 1e-26 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 MGHSN+WNSHPKTYGPGSR CRVCGNPH IIRKYG+MCCRQCFRSNAKEIGF+KYR Sbjct: 1 MGHSNVWNSHPKTYGPGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFVKYR 56 >ref|XP_002320698.2| hypothetical protein POPTR_0014s01800g [Populus trichocarpa] gi|550323136|gb|EEE99013.2| hypothetical protein POPTR_0014s01800g [Populus trichocarpa] Length = 90 Score = 125 bits (313), Expect = 1e-26 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 MGHSNIWNSHPK YGPGSRTCRVCGNPHGIIRKYG+MCCRQCFRSNAKEIGFIK R Sbjct: 1 MGHSNIWNSHPKNYGPGSRTCRVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKVR 56 >ref|NP_001294917.1| uncharacterized protein LOC544138 [Solanum lycopersicum] gi|565361057|ref|XP_006347277.1| PREDICTED: 40S ribosomal protein S29-like [Solanum tuberosum] gi|565367342|ref|XP_006350329.1| PREDICTED: 40S ribosomal protein S29-like [Solanum tuberosum] gi|697144498|ref|XP_009626362.1| PREDICTED: 40S ribosomal protein S29 [Nicotiana tomentosiformis] gi|697166313|ref|XP_009591987.1| PREDICTED: 40S ribosomal protein S29 [Nicotiana tomentosiformis] gi|698526017|ref|XP_009759838.1| PREDICTED: 40S ribosomal protein S29 [Nicotiana sylvestris] gi|698575940|ref|XP_009776080.1| PREDICTED: 40S ribosomal protein S29 [Nicotiana sylvestris] Length = 56 Score = 124 bits (312), Expect = 2e-26 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 MGHSNIWN+HPK YGPGSRTCRVCGNPH IIRKYG+MCCRQCFRSNAKEIGFIKYR Sbjct: 1 MGHSNIWNAHPKNYGPGSRTCRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_007223556.1| hypothetical protein PRUPE_ppa014535mg [Prunus persica] gi|645227016|ref|XP_008220312.1| PREDICTED: 40S ribosomal protein S29-like [Prunus mume] gi|657972348|ref|XP_008377973.1| PREDICTED: 40S ribosomal protein S29-like [Malus domestica] gi|657972352|ref|XP_008377975.1| PREDICTED: 40S ribosomal protein S29-like [Malus domestica] gi|658002509|ref|XP_008393747.1| PREDICTED: 40S ribosomal protein S29-like [Malus domestica] gi|694312002|ref|XP_009360488.1| PREDICTED: 40S ribosomal protein S29-like [Pyrus x bretschneideri] gi|694326383|ref|XP_009354108.1| PREDICTED: 40S ribosomal protein S29-like [Pyrus x bretschneideri] gi|462420492|gb|EMJ24755.1| hypothetical protein PRUPE_ppa014535mg [Prunus persica] Length = 56 Score = 124 bits (312), Expect = 2e-26 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 MGHSN+WNSHPK YGPGSRTCRVCGNPHG+IRKY +MCCRQCFRSNAKEIGFIKYR Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCRVCGNPHGLIRKYALMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_010679081.1| PREDICTED: 40S ribosomal protein S29 [Beta vulgaris subsp. vulgaris] gi|731336113|ref|XP_010679083.1| PREDICTED: 40S ribosomal protein S29 [Beta vulgaris subsp. vulgaris] gi|731340623|ref|XP_010681497.1| PREDICTED: 40S ribosomal protein S29 [Beta vulgaris subsp. vulgaris] gi|870856737|gb|KMT08336.1| hypothetical protein BVRB_6g141600 [Beta vulgaris subsp. vulgaris] gi|870858710|gb|KMT10198.1| hypothetical protein BVRB_5g119590 [Beta vulgaris subsp. vulgaris] gi|870858711|gb|KMT10199.1| hypothetical protein BVRB_5g119600 [Beta vulgaris subsp. vulgaris] Length = 56 Score = 124 bits (311), Expect = 2e-26 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -1 Query: 254 MGHSNIWNSHPKTYGPGSRTCRVCGNPHGIIRKYGIMCCRQCFRSNAKEIGFIKYR 87 MGHSNIWNSHPK+YGPGSR CRVCGNPH IIRKYG+MCCRQCFRSNAKEIGFIKYR Sbjct: 1 MGHSNIWNSHPKSYGPGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56