BLASTX nr result
ID: Forsythia21_contig00013520
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00013520 (337 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012827617.1| PREDICTED: tetrahydrocannabinolic acid synth... 58 3e-06 >ref|XP_012827617.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Erythranthe guttatus] gi|604299168|gb|EYU19103.1| hypothetical protein MIMGU_mgv1a003997mg [Erythranthe guttata] Length = 550 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/52 (46%), Positives = 35/52 (67%) Frame = +1 Query: 181 QAFLMCLREKAAGNGKILEDAYAPNSQRYLSLVELSQKNPRWLNSTLQLPLL 336 Q F+ C+ + ++G KIL+ + PNS Y+SL+E + +NPRW NST Q P L Sbjct: 28 QTFIQCISDHSSGQNKILQRIHTPNSPAYVSLLESAAQNPRWTNSTAQRPFL 79