BLASTX nr result
ID: Forsythia21_contig00011225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00011225 (527 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075092.1| PREDICTED: carbon catabolite repressor prote... 69 9e-10 emb|CDP10171.1| unnamed protein product [Coffea canephora] 68 2e-09 ref|XP_008442089.1| PREDICTED: carbon catabolite repressor prote... 67 5e-09 ref|XP_011653908.1| PREDICTED: carbon catabolite repressor prote... 67 5e-09 ref|XP_010257570.1| PREDICTED: carbon catabolite repressor prote... 66 8e-09 gb|EPS68733.1| hypothetical protein M569_06033 [Genlisea aurea] 66 8e-09 ref|XP_007029077.1| DNAse I-like superfamily protein isoform 1 [... 66 8e-09 gb|KDO70851.1| hypothetical protein CISIN_1g0074091mg, partial [... 65 1e-08 ref|XP_006429928.1| hypothetical protein CICLE_v10011329mg [Citr... 65 1e-08 ref|XP_012441508.1| PREDICTED: carbon catabolite repressor prote... 65 2e-08 ref|XP_011078811.1| PREDICTED: carbon catabolite repressor prote... 65 2e-08 ref|XP_011039501.1| PREDICTED: carbon catabolite repressor prote... 65 2e-08 gb|KHG30133.1| Carbon catabolite repressor 4 -like protein [Goss... 65 2e-08 ref|XP_010243421.1| PREDICTED: carbon catabolite repressor prote... 65 2e-08 ref|XP_009335881.1| PREDICTED: carbon catabolite repressor prote... 65 2e-08 ref|XP_008370952.1| PREDICTED: carbon catabolite repressor prote... 65 2e-08 ref|XP_008241168.1| PREDICTED: carbon catabolite repressor prote... 65 2e-08 ref|XP_008241167.1| PREDICTED: carbon catabolite repressor prote... 65 2e-08 ref|XP_012090837.1| PREDICTED: carbon catabolite repressor prote... 65 2e-08 ref|XP_007163037.1| hypothetical protein PHAVU_001G200700g [Phas... 65 2e-08 >ref|XP_011075092.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1-like [Sesamum indicum] Length = 603 Score = 69.3 bits (168), Expect = 9e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 MLSVLR+HLPSDIPIVGCELTPYVLLKRPD S+IT Sbjct: 1 MLSVLRVHLPSDIPIVGCELTPYVLLKRPDKSVIT 35 >emb|CDP10171.1| unnamed protein product [Coffea canephora] Length = 607 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 MLSVLR+HLPSDIPIVGCELTPYVL+KRPD S+IT Sbjct: 1 MLSVLRVHLPSDIPIVGCELTPYVLVKRPDKSVIT 35 >ref|XP_008442089.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1-like [Cucumis melo] Length = 602 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 ML VLR+HLPSDIPIVGCELTPY+LL+RPDTS+IT Sbjct: 1 MLIVLRVHLPSDIPIVGCELTPYLLLRRPDTSVIT 35 >ref|XP_011653908.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1-like [Cucumis sativus] gi|700199662|gb|KGN54820.1| Carbon catabolite repressor protein [Cucumis sativus] Length = 603 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 ML VLR+HLPSDIPIVGCELTPY+LL+RPDTS+IT Sbjct: 1 MLIVLRVHLPSDIPIVGCELTPYLLLRRPDTSVIT 35 >ref|XP_010257570.1| PREDICTED: carbon catabolite repressor protein 4 homolog 2-like [Nelumbo nucifera] Length = 601 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 MLSVLR+HLPSDIPIVGCELTPYVLL+RPD SI T Sbjct: 1 MLSVLRVHLPSDIPIVGCELTPYVLLRRPDGSITT 35 >gb|EPS68733.1| hypothetical protein M569_06033 [Genlisea aurea] Length = 600 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/35 (82%), Positives = 35/35 (100%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 MLSVLR+HLPS+IPIVGCELTPYVLLKRPD+S+++ Sbjct: 1 MLSVLRVHLPSEIPIVGCELTPYVLLKRPDSSVLS 35 >ref|XP_007029077.1| DNAse I-like superfamily protein isoform 1 [Theobroma cacao] gi|508717682|gb|EOY09579.1| DNAse I-like superfamily protein isoform 1 [Theobroma cacao] Length = 602 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 MLSVLR+HLPSDIPIVGCELTPYVLL+RPD S+ T Sbjct: 1 MLSVLRVHLPSDIPIVGCELTPYVLLRRPDKSVTT 35 >gb|KDO70851.1| hypothetical protein CISIN_1g0074091mg, partial [Citrus sinensis] gi|641851982|gb|KDO70852.1| hypothetical protein CISIN_1g0074091mg, partial [Citrus sinensis] gi|641851983|gb|KDO70853.1| hypothetical protein CISIN_1g0074091mg, partial [Citrus sinensis] gi|641851984|gb|KDO70854.1| hypothetical protein CISIN_1g0074091mg, partial [Citrus sinensis] gi|641851985|gb|KDO70855.1| hypothetical protein CISIN_1g0074091mg, partial [Citrus sinensis] Length = 52 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 MLSVLR+HLPSDIPIVGCELTPYVLL+RPD ++ T Sbjct: 1 MLSVLRVHLPSDIPIVGCELTPYVLLRRPDNAVTT 35 >ref|XP_006429928.1| hypothetical protein CICLE_v10011329mg [Citrus clementina] gi|567874679|ref|XP_006429929.1| hypothetical protein CICLE_v10011329mg [Citrus clementina] gi|567874681|ref|XP_006429930.1| hypothetical protein CICLE_v10011329mg [Citrus clementina] gi|568879775|ref|XP_006492821.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1-like [Citrus sinensis] gi|557531985|gb|ESR43168.1| hypothetical protein CICLE_v10011329mg [Citrus clementina] gi|557531986|gb|ESR43169.1| hypothetical protein CICLE_v10011329mg [Citrus clementina] gi|557531987|gb|ESR43170.1| hypothetical protein CICLE_v10011329mg [Citrus clementina] Length = 604 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 MLSVLR+HLPSDIPIVGCELTPYVLL+RPD ++ T Sbjct: 1 MLSVLRVHLPSDIPIVGCELTPYVLLRRPDNAVTT 35 >ref|XP_012441508.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1 [Gossypium raimondii] gi|823217703|ref|XP_012441509.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1 [Gossypium raimondii] gi|763794940|gb|KJB61936.1| hypothetical protein B456_009G392500 [Gossypium raimondii] gi|763794941|gb|KJB61937.1| hypothetical protein B456_009G392500 [Gossypium raimondii] gi|763794942|gb|KJB61938.1| hypothetical protein B456_009G392500 [Gossypium raimondii] Length = 602 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 MLSVLR+HLPSDIPIVGCELTPYVLL+RPD ++ T Sbjct: 1 MLSVLRVHLPSDIPIVGCELTPYVLLRRPDKTVTT 35 >ref|XP_011078811.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1-like [Sesamum indicum] Length = 599 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 ML+VLR+HLPSDIPIVGCELTPYVLLKR D S+IT Sbjct: 1 MLTVLRVHLPSDIPIVGCELTPYVLLKRADKSVIT 35 >ref|XP_011039501.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1-like isoform X1 [Populus euphratica] gi|743891955|ref|XP_011039502.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1-like isoform X1 [Populus euphratica] Length = 603 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 MLSV+R+HLPSDIPIVGCELTPYVLL+RPDT+ T Sbjct: 1 MLSVIRVHLPSDIPIVGCELTPYVLLRRPDTNATT 35 >gb|KHG30133.1| Carbon catabolite repressor 4 -like protein [Gossypium arboreum] Length = 599 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 MLSVLR+HLPSDIPIVGCELTPYVLL+RPD ++ T Sbjct: 1 MLSVLRVHLPSDIPIVGCELTPYVLLRRPDKTVTT 35 >ref|XP_010243421.1| PREDICTED: carbon catabolite repressor protein 4 homolog 2-like [Nelumbo nucifera] Length = 601 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 MLSVLR+HLPSDIPIVGCELTPYVLL+RPD SI T Sbjct: 1 MLSVLRVHLPSDIPIVGCELTPYVLLRRPDGSIGT 35 >ref|XP_009335881.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1 [Pyrus x bretschneideri] gi|694415411|ref|XP_009335882.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1 [Pyrus x bretschneideri] gi|694415413|ref|XP_009335883.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1 [Pyrus x bretschneideri] Length = 603 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 MLSVLR+HLPSDIPIVGCELTPYVLL+RPD ++ T Sbjct: 1 MLSVLRVHLPSDIPIVGCELTPYVLLRRPDKNVTT 35 >ref|XP_008370952.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1-like [Malus domestica] gi|657958829|ref|XP_008370953.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1-like [Malus domestica] gi|657958831|ref|XP_008370954.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1-like [Malus domestica] Length = 603 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 MLSVLR+HLPSDIPIVGCELTPYVLL+RPD ++ T Sbjct: 1 MLSVLRVHLPSDIPIVGCELTPYVLLRRPDKNVTT 35 >ref|XP_008241168.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1 isoform X2 [Prunus mume] Length = 603 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 MLSVLR+HLPSDIPIVGCELTPYVLL+RPD ++ T Sbjct: 1 MLSVLRVHLPSDIPIVGCELTPYVLLRRPDKTVTT 35 >ref|XP_008241167.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1 isoform X1 [Prunus mume] Length = 604 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 MLSVLR+HLPSDIPIVGCELTPYVLL+RPD ++ T Sbjct: 1 MLSVLRVHLPSDIPIVGCELTPYVLLRRPDKTVTT 35 >ref|XP_012090837.1| PREDICTED: carbon catabolite repressor protein 4 homolog 1-like [Jatropha curcas] gi|643705350|gb|KDP21896.1| hypothetical protein JCGZ_03034 [Jatropha curcas] Length = 603 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 MLSVLR+HLPSDIPIVGCELTPYVLL+RPD ++ T Sbjct: 1 MLSVLRVHLPSDIPIVGCELTPYVLLRRPDKTVTT 35 >ref|XP_007163037.1| hypothetical protein PHAVU_001G200700g [Phaseolus vulgaris] gi|593800001|ref|XP_007163038.1| hypothetical protein PHAVU_001G200700g [Phaseolus vulgaris] gi|561036501|gb|ESW35031.1| hypothetical protein PHAVU_001G200700g [Phaseolus vulgaris] gi|561036502|gb|ESW35032.1| hypothetical protein PHAVU_001G200700g [Phaseolus vulgaris] Length = 600 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 107 MLSVLRLHLPSDIPIVGCELTPYVLLKRPDTSIIT 3 MLSVLR+HLPSDIPIVGCELTPYVLL+RPD ++ T Sbjct: 1 MLSVLRVHLPSDIPIVGCELTPYVLLRRPDKTVTT 35