BLASTX nr result
ID: Forsythia21_contig00011207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00011207 (534 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO97564.1| unnamed protein product [Coffea canephora] 59 1e-06 ref|XP_011073442.1| PREDICTED: probable inactive tRNA-specific a... 58 3e-06 >emb|CDO97564.1| unnamed protein product [Coffea canephora] Length = 443 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -1 Query: 534 VHRLQGERSLNHHYAVFRVLIPEDVLLSEALFAITAEN 421 VHRLQGERSLNHHYAVFRVL+PE+++ E L +I + N Sbjct: 401 VHRLQGERSLNHHYAVFRVLLPEEMVKDETLVSIISNN 438 >ref|XP_011073442.1| PREDICTED: probable inactive tRNA-specific adenosine deaminase-like protein 3 [Sesamum indicum] Length = 417 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 534 VHRLQGERSLNHHYAVFRVLIPEDVLLSEAL 442 VHRLQGERSLNHHYAVFRV +PE++L SEAL Sbjct: 380 VHRLQGERSLNHHYAVFRVSLPEEILKSEAL 410