BLASTX nr result
ID: Forsythia21_contig00010816
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00010816 (520 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB69727.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [... 66 1e-08 gb|AID51438.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3... 65 1e-08 gb|AID51437.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2... 65 1e-08 ref|XP_009599355.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy... 65 1e-08 ref|XP_010094509.1| 3-hydroxy-3-methylglutaryl-coenzyme A reduct... 65 2e-08 gb|AAD03789.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [... 65 2e-08 gb|AEU08408.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [... 65 2e-08 ref|XP_003612421.1| 3-hydroxy-3-methylglutaryl coenzyme A reduct... 65 2e-08 gb|KHN39534.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [... 65 2e-08 gb|KHM99121.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [... 65 2e-08 gb|AIX87980.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [... 65 2e-08 gb|ADC44451.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1... 65 2e-08 gb|ACT65734.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [... 65 2e-08 gb|AHB64333.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [... 65 2e-08 ref|XP_007141592.1| hypothetical protein PHAVU_008G208900g [Phas... 65 2e-08 ref|XP_003545556.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy... 65 2e-08 gb|AAU87798.1| HMGR [Salvia miltiorrhiza] 65 2e-08 emb|CDP07253.1| unnamed protein product [Coffea canephora] 64 3e-08 ref|XP_004512291.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy... 64 3e-08 sp|O64966.1|HMDH1_GOSHI RecName: Full=3-hydroxy-3-methylglutaryl... 64 4e-08 >gb|AAB69727.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Camptotheca acuminata] Length = 589 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSAIAAGQLVKSHMKYNRSSKD+TK+SS Sbjct: 556 AGELSLMSAIAAGQLVKSHMKYNRSSKDITKVSS 589 >gb|AID51438.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 [Astragalus membranaceus] Length = 568 Score = 65.5 bits (158), Expect = 1e-08 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKI+S Sbjct: 535 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKIAS 568 >gb|AID51437.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 [Astragalus membranaceus] Length = 569 Score = 65.5 bits (158), Expect = 1e-08 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKI+S Sbjct: 536 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKIAS 569 >ref|XP_009599355.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Nicotiana tomentosiformis] gi|2654423|gb|AAB87727.1| hydroxy-methylglutaryl-coenzyme A reductase [Nicotiana tabacum] Length = 604 Score = 65.5 bits (158), Expect = 1e-08 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSAI+AGQLVKSHMKYNRSSKDVTKISS Sbjct: 571 AGELSLMSAISAGQLVKSHMKYNRSSKDVTKISS 604 >ref|XP_010094509.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Morus notabilis] gi|587866825|gb|EXB56263.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Morus notabilis] Length = 548 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTK++S Sbjct: 515 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKVTS 548 >gb|AAD03789.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Morus alba] Length = 548 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTK++S Sbjct: 515 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKVAS 548 >gb|AEU08408.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Clematis armandii] Length = 578 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSAI+AGQLVKSHMKYNRSSKD+TKISS Sbjct: 545 AGELSLMSAISAGQLVKSHMKYNRSSKDITKISS 578 >ref|XP_003612421.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Medicago truncatula] gi|162945930|gb|ABY20974.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 3 [Medicago truncatula] gi|355513756|gb|AES95379.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like protein [Medicago truncatula] Length = 567 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTK++S Sbjct: 534 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKVTS 567 >gb|KHN39534.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Glycine soja] Length = 175 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSAIAAGQLV SHMKYNRSSKDVTKISS Sbjct: 141 AGELSLMSAIAAGQLVNSHMKYNRSSKDVTKISS 174 >gb|KHM99121.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Glycine soja] Length = 353 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSAIAAGQLV SHMKYNRSSKDVTKISS Sbjct: 319 AGELSLMSAIAAGQLVNSHMKYNRSSKDVTKISS 352 >gb|AIX87980.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Panax ginseng] Length = 594 Score = 64.7 bits (156), Expect = 2e-08 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSA+AAGQLVKSHMKYNRSSKD+TK+SS Sbjct: 561 AGELSLMSALAAGQLVKSHMKYNRSSKDITKLSS 594 >gb|ADC44451.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Salvia miltiorrhiza] Length = 550 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTK+S+ Sbjct: 517 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKLST 550 >gb|ACT65734.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Salvia miltiorrhiza] Length = 550 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTK+S+ Sbjct: 517 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKLST 550 >gb|AHB64333.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Camellia sinensis] Length = 573 Score = 64.7 bits (156), Expect = 2e-08 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSAIAAGQLVKSHMKYNRSSKD+TK++S Sbjct: 539 AGELSLMSAIAAGQLVKSHMKYNRSSKDITKVAS 572 >ref|XP_007141592.1| hypothetical protein PHAVU_008G208900g [Phaseolus vulgaris] gi|561014725|gb|ESW13586.1| hypothetical protein PHAVU_008G208900g [Phaseolus vulgaris] Length = 567 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSAIAAGQLV SHMKYNRSSKDVTKISS Sbjct: 534 AGELSLMSAIAAGQLVNSHMKYNRSSKDVTKISS 567 >ref|XP_003545556.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like [Glycine max] Length = 565 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSAIAAGQLV SHMKYNRSSKDVTKISS Sbjct: 531 AGELSLMSAIAAGQLVNSHMKYNRSSKDVTKISS 564 >gb|AAU87798.1| HMGR [Salvia miltiorrhiza] Length = 267 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTK+S+ Sbjct: 234 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKLST 267 >emb|CDP07253.1| unnamed protein product [Coffea canephora] Length = 572 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSAIAAGQLVKSHMKYNRSS+DVTKI+S Sbjct: 539 AGELSLMSAIAAGQLVKSHMKYNRSSRDVTKIAS 572 >ref|XP_004512291.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like [Cicer arietinum] Length = 569 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSAIAAGQLVKSHMKYNRSS+DVTKI+S Sbjct: 536 AGELSLMSAIAAGQLVKSHMKYNRSSRDVTKIAS 569 >sp|O64966.1|HMDH1_GOSHI RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 1; Short=HMG-CoA reductase 1 [Gossypium hirsutum] gi|2935298|gb|AAC05088.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Gossypium hirsutum] Length = 585 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -1 Query: 520 AGELSLMSAIAAGQLVKSHMKYNRSSKDVTKISS 419 AGELSLMSA+AAGQLVKSHMKYNRSSKDV+K+SS Sbjct: 552 AGELSLMSALAAGQLVKSHMKYNRSSKDVSKVSS 585