BLASTX nr result
ID: Forsythia21_contig00010645
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00010645 (197 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089745.1| PREDICTED: putative late blight resistance p... 59 2e-06 ref|XP_011091064.1| PREDICTED: putative late blight resistance p... 58 2e-06 ref|XP_011071971.1| PREDICTED: putative late blight resistance p... 58 3e-06 ref|XP_006366307.1| PREDICTED: putative late blight resistance p... 57 5e-06 >ref|XP_011089745.1| PREDICTED: putative late blight resistance protein homolog R1A-10 [Sesamum indicum] Length = 894 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/59 (50%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = -2 Query: 175 FPNEVAEWVDLRYLD-CISMHIPSSISKLQNLQTIILRRDMRPLYLSLDIWKMPQLRHV 2 FP E+ E + LRYL I+ +P SI KLQNLQT+I+ YL +IW MPQLRH+ Sbjct: 579 FPIEIVELIHLRYLALAINCELPRSIFKLQNLQTLIIDHIWEGQYLPREIWMMPQLRHI 637 >ref|XP_011091064.1| PREDICTED: putative late blight resistance protein homolog R1B-16 [Sesamum indicum] Length = 856 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 1/60 (1%) Frame = -2 Query: 178 EFPNEVAEWVDLRYLDCI-SMHIPSSISKLQNLQTIILRRDMRPLYLSLDIWKMPQLRHV 2 +FP E+ E V+LRYL + IPS+IS+L NLQT+I+ +R L +IW+MP+LRH+ Sbjct: 565 QFPTEILELVNLRYLAFYCNSEIPSAISRLWNLQTLIVGSILRSFELPSEIWEMPELRHI 624 >ref|XP_011071971.1| PREDICTED: putative late blight resistance protein homolog R1A-10 [Sesamum indicum] Length = 872 Score = 57.8 bits (138), Expect = 3e-06 Identities = 31/66 (46%), Positives = 44/66 (66%), Gaps = 6/66 (9%) Frame = -2 Query: 181 LEFPNEVAEWVDLRYLDCI-SMHIPSSISKLQNLQTIILRRDMRPLYLS-----LDIWKM 20 +EFP EV + LRYL + IPSSISKL+NLQ +I+R+ + ++L ++IW M Sbjct: 573 IEFPKEVVALIHLRYLSLTYNGKIPSSISKLRNLQVLIVRQHPKIIFLGASILPVEIWNM 632 Query: 19 PQLRHV 2 PQLRH+ Sbjct: 633 PQLRHL 638 >ref|XP_006366307.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like isoform X1 [Solanum tuberosum] gi|565401646|ref|XP_006366308.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like isoform X2 [Solanum tuberosum] Length = 887 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/60 (46%), Positives = 40/60 (66%), Gaps = 2/60 (3%) Frame = -2 Query: 175 FPNEVAEWVDLRYLDCISMH--IPSSISKLQNLQTIILRRDMRPLYLSLDIWKMPQLRHV 2 FPNE+ + V LRY+ +P+SISKL NL+T+I+R R L + +DIWKM Q +H+ Sbjct: 577 FPNEIVQLVHLRYIALSGNFRVLPASISKLWNLETLIVRTKSRELDIQVDIWKMSQFKHL 636